DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4a10 and Cyp4c3

DIOPT Version :9

Sequence 1:NP_034141.3 Gene:Cyp4a10 / 13117 MGIID:88611 Length:509 Species:Mus musculus
Sequence 2:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster


Alignment Length:533 Identity:163/533 - (30%)
Similarity:276/533 - (51%) Gaps:74/533 - (13%)


- Green bases have known domain annotations that are detailed below.


Mouse    15 LSGFLQV-ASVLGLLLLLVKAVQFYLHRQWLLKAFQQFPSPPFHWFFGH---------EKFK--- 66
            :||:..: ..:||.:|:.:  |.:...|..|:|..::.|.|....|.|:         |.|.   
  Fly    23 ISGYSPITVFLLGSILIFL--VVYNKRRSRLVKYIEKIPGPAAMPFLGNAIEMNVDHDELFNRVI 85

Mouse    67 GDQELQEIVSCIENFPSAFPRWFWGSKAYLT-----------VYDPDYMKVILGRSDPKANGA-- 118
            |.|:|                  ||::..:.           :::|:.::.|| .|....|.:  
  Fly    86 GMQKL------------------WGTRIGINRVWQGTAPRVLLFEPETVEPIL-NSQKFVNKSHD 131

Mouse   119 YRLLAPWIGYGLLLLNGQPWFQHRRMLTPAFHYDILKPYVKNMADSIRLMLDKWERLADQ--DSS 181
            |..|.||:|.|||....:.|...|::||||||:.||..::....:...::..|   ||.:  ..:
  Fly   132 YDYLHPWLGEGLLTSTDRKWHSRRKILTPAFHFKILDDFIDVFNEQSAVLARK---LAVEVGSEA 193

Mouse   182 IEIFQHISLMTLDTVMKCAFSHKGSVQVDGNYRT-YLQAIGDLNNLFHSRVRNIFHQNDTIYKLS 245
            ..:|.:::|.|||.|.:.|...:  :....|..: |::|:..:.::..||...|:.|:|.|:.|:
  Fly   194 FNLFPYVTLCTLDIVCETAMGRR--IYAQSNSESEYVKAVYGIGSIVQSRQAKIWLQSDFIFSLT 256

Mouse   246 SNGRLAKQACQLAHDHTDGVIKLRKDQ---LQDEGE---------LEKIKKKRRLDFLDILLFAR 298
            :..:|.:......|..::.||:.||.:   ||:...         .:.:.||:||.|||:|:.|.
  Fly   257 AEYKLHQSYINTLHGFSNMVIRERKAELAILQENNNNNNNNAPDAYDDVGKKKRLAFLDLLIDAS 321

Mouse   299 MENGDSMSDKDLRAEVDTFMFEGHDTTASGVSWIFYALATHPDHQQRCREEVQSLLGDG--SSIT 361
            .| |..:|::|:|.|||||||||||||::.:||..:.|..||::|:|..||:.|:.||.  :..|
  Fly   322 KE-GTVLSNEDIREEVDTFMFEGHDTTSAAISWTLFLLGCHPEYQERVVEELDSIFGDDKETPAT 385

Mouse   362 WDHLDQIPYTTMCIKEALRLYPPVPGIVRELSTSVTFPDGRSLPKGVQVTLSIYGLHHNPKVWPN 426
            ..:|..:.|...|||::|||:|.||.:.|.:...|.. .|:.:|.|.|..:..|.||.||:|:|.
  Fly   386 MKNLMDMRYLECCIKDSLRLFPSVPMMARMVGEDVNI-GGKIVPAGTQAIIMTYALHRNPRVFPK 449

Mouse   427 PEVFDPSRFAPD--SPRHSHSFLPFSGGARNCIGKQFAMSELKVIVALTLLRFELLPDPTRVPMP 489
            ||.|:|..|.|:  :.||..:::|||.|.|||||::||:.|.|.:::..|.::::.....|..:.
  Fly   450 PEQFNPDNFLPENCAGRHPFAYIPFSAGPRNCIGQKFAILEEKAVISTVLRKYKIEAVDRREDLT 514

Mouse   490 -LARLVLKSKNGI 501
             |..|:|:.|:|:
  Fly   515 LLGELILRPKDGL 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4a10NP_034141.3 p450 52..503 CDD:278495 154/495 (31%)
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 154/495 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844978
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.640

Return to query results.
Submit another query.