DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4a10 and Cyp9c1

DIOPT Version :9

Sequence 1:NP_034141.3 Gene:Cyp4a10 / 13117 MGIID:88611 Length:509 Species:Mus musculus
Sequence 2:NP_523850.1 Gene:Cyp9c1 / 37941 FlyBaseID:FBgn0015040 Length:522 Species:Drosophila melanogaster


Alignment Length:433 Identity:108/433 - (24%)
Similarity:177/433 - (40%) Gaps:90/433 - (20%)


- Green bases have known domain annotations that are detailed below.


Mouse   126 IGYGLLLLNGQPWFQHRRMLTPAFHYDILKPYVKNMADSIRL----MLDKWERLADQDSS-IEIF 185
            |...||.|..:.|.|.|..|||.|  ..||  ::.|.:.|..    .:|..:|..|..:| :|:.
  Fly   119 ISKSLLSLRDRRWKQMRSTLTPTF--TSLK--IRQMFELIHFCNVEAVDFVQRQLDAGTSELELK 179

Mouse   186 QHISLMTLDTVMKCAFSHKGSVQVDGNYRTYLQAIGDLNNLFHSRVRNIFH------QNDTIYKL 244
            ...:..|.|.:...||    .:||:        :..|.||.|.|..:.|..      ....:|.|
  Fly   180 DFFTRYTNDVIATAAF----GIQVN--------SFKDPNNEFFSIGQRISEFTFWGGLKVMLYIL 232

Mouse   245 SSNGRLAKQACQLAHDHTD-------GVIKLRKDQ-------------------LQDEGELEKIK 283
            ......|.:...:..::.|       |.:|.||:|                   .:.||..|...
  Fly   233 MPKLMKALRVPVMDMNNVDYFKKLVFGAMKYRKEQSIVRPDMIHLLMEAQRQFKAEQEGSAESAA 297

Mouse   284 KKRRLDFLDILLFARMENGDSMSDKDLRAEVDTFMFEGHDTTASGVSWIFYALATHPDHQQRCRE 348
            ::.:.:|               :|.||.|:...|...|.:|.|:.:|:..|.|..:|:.|::...
  Fly   298 QQDKAEF---------------NDDDLLAQCLLFFSAGFETVATCLSFTSYELMMNPEVQEKLLA 347

Mouse   349 E---VQSLLGDGSSITWDHLDQIPYTTMCIKEALRLYPPVPGIVRELSTSVTFPDGR-----SLP 405
            |   |:..||: ..:.:|.|..:.|....:.|:||.:||...:.|...:.....|..     :|.
  Fly   348 EILAVKEQLGE-KPLDYDTLMGMKYLNCVVSESLRKWPPAFIVDRMCGSDFQLKDEEGEVVVNLR 411

Mouse   406 KGVQVTLSIYGLHHNPKVWPNPEVFDPSRFAPDSPRHSH-----SFLPFSGGARNCIGKQFAMSE 465
            :...|.:::..|||:|..:|.||.|.|.||   ...|.|     ::|||..|.|:|||.:.|:.|
  Fly   412 EDDLVHINVGALHHDPDNFPEPEQFRPERF---DEEHKHEIRQFTYLPFGVGQRSCIGNRLALME 473

Mouse   466 LKVIVALTLLRFELLPDPTRVPMPLARLVLKSKNGIYLHLKKL 508
            :|.::...:||:.|.| ..|.|..:    :.|.:|..|..::|
  Fly   474 VKSLIFQLVLRYHLKP-TDRTPADM----MSSISGFRLLPREL 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4a10NP_034141.3 p450 52..503 CDD:278495 106/426 (25%)
Cyp9c1NP_523850.1 p450 37..514 CDD:299894 108/433 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.