DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4a10 and Cyp4ac3

DIOPT Version :9

Sequence 1:NP_034141.3 Gene:Cyp4a10 / 13117 MGIID:88611 Length:509 Species:Mus musculus
Sequence 2:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster


Alignment Length:399 Identity:127/399 - (31%)
Similarity:218/399 - (54%) Gaps:24/399 - (6%)


- Green bases have known domain annotations that are detailed below.


Mouse   116 NGAYRLLAPWIGYGLLLLNGQPWFQHRRMLTPAFHYDILKPYVKNMADSIRLMLDKWERLADQD- 179
            |.:|.|:.|::|.|||:...|.|...|:.||||||::||:.::....:..:    |:.::.|:: 
  Fly   117 NMSYELIRPFLGDGLLISIDQKWHTRRKTLTPAFHFNILQSFLSIFKEESK----KFIKILDKNV 177

Mouse   180 -SSIEIFQHISLMTLDTVMKCAFSHKGSVQVDGNYRTYLQAIGDLNNLFHSRVRNIFHQNDTIYK 243
             ..:|:.|.|...||:.:.:.|...|.....:||  .|.:||.|...:|:.|:.|.....:..:.
  Fly   178 GFELELNQIIPQFTLNNICETALGVKLDDMSEGN--EYRKAIHDFEIVFNQRMCNPLMFFNWYFF 240

Mouse   244 LSSNGRLAKQACQLAHDHTDGVIKLRKDQLQDE--GELEKIKKKRRLDFLDILLFARMENGDSMS 306
            |..:.:...:..:..|..:.|:|:.::.|.:.:  |::::..||:|...||.||.|..|.  .:.
  Fly   241 LFGDYKKYSRILRTIHGFSSGIIQRKRQQFKQKQLGQVDEFGKKQRYAMLDTLLAAEAEG--KID 303

Mouse   307 DKDLRAEVDTFMFEGHDTTASGVSWIFYALATHPDHQQRCREEVQSLLGDGSSITWDHLDQIPYT 371
            .:.:..||:||||.|:|||::.:.:....||.|.|.|:||.||:|.|..|...::....:::.:.
  Fly   304 HQGICDEVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDLPEDIDEVSMFQFNELIHL 368

Mouse   372 TMCIKEALRLYPPVPGIVRE-LSTSVTFPDGRSLPKGVQVTLSIYGLHHNPKVWPNPEVFDPSRF 435
            ...|||:|||:|..|.|.|. :..||.  :|..|||..|:::.||.:..:.:.:|.|..|.|.||
  Fly   369 ECVIKESLRLFPSAPIIGRTCIEESVM--NGLVLPKNAQISIHIYDIMRDARHFPKPNQFLPERF 431

Mouse   436 APDSP--RHSHSFLPFSGGARNCIGKQFAMSELKVIVALTLLRFELLPDPTRVPMPLARLVLKSK 498
            .|::.  ||..:|:|||.|.|||||::|.:.|:||::|..:..|:||| .|::.      .|..:
  Fly   432 LPENSVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNFKLLP-ATQLE------DLTFE 489

Mouse   499 NGIYLHLKK 507
            |||.|..::
  Fly   490 NGIVLRTQQ 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4a10NP_034141.3 p450 52..503 CDD:278495 126/393 (32%)
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 127/399 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845282
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.