DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4a10 and Cyp28c1

DIOPT Version :9

Sequence 1:NP_034141.3 Gene:Cyp4a10 / 13117 MGIID:88611 Length:509 Species:Mus musculus
Sequence 2:NP_001259464.1 Gene:Cyp28c1 / 32138 FlyBaseID:FBgn0030339 Length:505 Species:Drosophila melanogaster


Alignment Length:522 Identity:123/522 - (23%)
Similarity:203/522 - (38%) Gaps:129/522 - (24%)


- Green bases have known domain annotations that are detailed below.


Mouse    60 FGHEKFKGDQELQEIVSCIENFP--SAFPRWFWGSKAYLTVYDPDYMKVILGRSDPKANGAYRLL 122
            |||.:.:|..|.:.:       |  .:||...|..:.:.......||..   |:.....|.|.|.
  Fly    24 FGHWRRRGVTEPRAL-------PLFGSFPNMIWPRQHFTMDMRDIYMHY---RNTHSYVGCYLLR 78

Mouse   123 APWIGYGLLLLNGQPWFQHRRMLTPAFHYD----------------ILKPYV------------- 158
            ||    .||:|  :|...:...::...|::                .|.|:|             
  Fly    79 AP----KLLVL--EPRLVYEIYVSAFSHFENNDASKMVDIAKDRLVALNPFVLEGEEWRHQRAVF 137

Mouse   159 ----------KNMADSIRLMLDKWERLADQDSSIEIFQHISL---MTLDTVMKCAF--------- 201
                      ...|...|:.||..:.:|.:.:..:....|.|   .|.:::..|..         
  Fly   138 STLLTNGRIRTTHAIMQRVCLDLCQFIAIKSAGGKDLDCIDLGLRFTGESLFDCVLGIQARTFTD 202

Mouse   202 --------SHKGSVQVDGNYRTYLQAIGDLNNLFHSRVR----NIF-HQNDTIYKLSSNGRLAKQ 253
                    :|:.|.:..|     |...|.::.||.:..|    .:| ..:|..|     |::..:
  Fly   203 NPLPVVRQNHEMSAENRG-----LAIAGAVHGLFPNLPRWLRPKVFPRSHDRFY-----GQMISE 257

Mouse   254 ACQLAHDHTDGVIKLRKDQLQDEGELEKIKKKRRLDFLDILLFARMENGDSMSDKDLRAEVDTFM 318
            |           ::||:.           |.:.|.||::.||  .|:....:|::|:.:...|||
  Fly   258 A-----------LRLRRS-----------KHQERNDFINHLL--EMQRELDLSEEDMASHAMTFM 298

Mouse   319 FEGHDTTASGVSWIFYALATHPDHQQRCREEVQSLLGDGSSITWDHLDQIPYTTMCIKEALRLYP 383
            |:|.|||::.::.....|..:||.|:|..||:|.:...|.....|.|..:||.:.|..|:||:| 
  Fly   299 FDGLDTTSNSIAHCLLLLGRNPDCQRRLYEELQLVNPGGYLPDLDALIDLPYLSACFNESLRIY- 362

Mouse   384 PVPGIVRELSTSVTFPDGR------SLPKGVQVTLSIYGLHHNPKVWPNPEVFDPSRFAPDSPRH 442
            |..|...:..|......|.      .|..|..|.:.||.||::|.::|.|:||.|.||.....::
  Fly   363 PAGGWASKTCTKEYELRGSHHSEPLKLRPGDHVMVPIYALHNDPDLYPEPDVFRPERFLDGGLKN 427

Mouse   443 SHS---FLPFSGGARNCIGKQFAMSELKVIVALTLLRFELLPDP-TRVPMPLARLVLKS--KNGI 501
            ...   ||.|..|.|.|:|.:..::..|..:|..:.|||::..| |.....|..|:...  |.||
  Fly   428 CKQQGIFLGFGNGPRQCVGMRLGLAMAKAALAAIVQRFEVVVSPRTLNGTELDPLIFVGVHKGGI 492

Mouse   502 YL 503
            :|
  Fly   493 WL 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4a10NP_034141.3 p450 52..503 CDD:278495 122/520 (23%)
Cyp28c1NP_001259464.1 p450 35..487 CDD:299894 114/502 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.