DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp46a1 and Cyp4e1

DIOPT Version :9

Sequence 1:NP_034140.1 Gene:Cyp46a1 / 13116 MGIID:1341877 Length:500 Species:Mus musculus
Sequence 2:NP_524771.1 Gene:Cyp4e1 / 44632 FlyBaseID:FBgn0015034 Length:531 Species:Drosophila melanogaster


Alignment Length:469 Identity:123/469 - (26%)
Similarity:209/469 - (44%) Gaps:70/469 - (14%)


- Green bases have known domain annotations that are detailed below.


Mouse    64 FLDWAKKYG-PVVRVNVFYKTSVIVTSPESVKKFLMSTKYNKDSKMYRALQTVFGERLFGQGLVS 127
            |..|..:|| ...|..:.|.::::||:|:.::..|.|......|.:|.....     ..|.||::
  Fly    59 FFGWWHEYGKDNFRYWIGYYSNIMVTNPKYMEFILSSQTLISKSDVYDLTHP-----WLGLGLLT 118

Mouse   128 ECDYGRWYKQRKVMDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSMQDMLTCATIDIL 192
            ... .:|:|.||::..||..:.|....|..||.:.:.::.|:..|||......|:.....|:|::
  Fly   119 STG-SKWHKHRKMITPAFHFNILQDFHEVMNENSTKFIDQLKKVADGGNIFDFQEEAHYLTLDVI 182

Mouse   193 AKAAFGMETSMLLGAQKPLSQAVKVMLEGISASRNTLAKFMPGKRK--------QLREIRESIRL 249
            ...|.|:..:.:......:.||.|.:...|.     :..|.|.||.        :..|..::::.
  Fly   183 CDTAMGVSINAMENRSSSVVQAFKDITYTIK-----MRAFSPWKRNKYLFHFAPEYPEYSKTLKT 242

Mouse   250 LRQVGKDWVQRRREALKRGEDMPADILTQILKAEEGAQDDEVLLDNFV----------------- 297
            |:....:.:.:|.|..|.|.::.       :||:|.::.....||..:                 
  Fly   243 LQDFTNEIIAKRIEVRKSGLEVG-------IKADEFSRKKMAFLDTLLSSKVDGRPLTSQELYEE 300

Mouse   298 --TFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVVGSK---RHLDYEDLGRLQYLSQVL 357
              ||...||:|:.:.:.|.|..|||.|:...:|..|..:|:|:.   |...::::..:::|...:
  Fly   301 VSTFMFEGHDTTTSGVGFAVYLLSRHPDEQEKLFNEQCDVMGASGLGRDATFQEISTMKHLDLFI 365

Mouse   358 KESLRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGAPK 422
            ||:.||||......|..|::.:|||..||..|.|.....::|..|..|:||..|.|:||....|.
  Fly   366 KEAQRLYPSVPFIGRFTEKDYVIDGDIVPKGTTLNLGLLMLGYNDRVFKDPHKFQPERFDREKPG 430

Mouse   423 PRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRIEFRLVP------------GQRFGLQ---- 471
            | |.|.|||.|.|:||||:||.:|:|.|::|:::  .|.::|            ....|||    
  Fly   431 P-FEYVPFSAGPRNCIGQKFALLEIKTVVSKIIR--NFEVLPALDELVSKDGYISTTLGLQPAEK 492

Mouse   472 --EQATLKPLDPVL 483
              ..|.....||:|
  Fly   493 KSRDAHNHKYDPIL 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp46a1NP_034140.1 p450 34..466 CDD:278495 116/444 (26%)
Cyp4e1NP_524771.1 p450 34..469 CDD:278495 115/430 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.