DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp46a1 and Cyp313a1

DIOPT Version :9

Sequence 1:NP_034140.1 Gene:Cyp46a1 / 13116 MGIID:1341877 Length:500 Species:Mus musculus
Sequence 2:NP_650368.1 Gene:Cyp313a1 / 41759 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster


Alignment Length:502 Identity:106/502 - (21%)
Similarity:199/502 - (39%) Gaps:130/502 - (25%)


- Green bases have known domain annotations that are detailed below.


Mouse     4 GLLLLGSAV--LLAFGLCCTFVHRARSRYEHIPGPPRPSFLLGHLPYFWKKDEDCGRVLQDVFLD 66
            ||.:|||::  ::.:....:|    |::|.:..|....:: :|.:|:...:|.   :|::|:|  
  Fly    37 GLPILGSSLENIITYKRKLSF----RTKYLNKYGSTILTW-MGPVPFIVTRDP---KVVEDIF-- 91

Mouse    67 WAKKYGPVVRVNVFYKTSVIVTSPESVKKFLMSTKYNKDSKMYRALQTVFGERLFGQGLVSECDY 131
                                 :||:.         :||...:..|:.:..|..|.|:      ..
  Fly    92 ---------------------SSPDC---------HNKSQHIVNAITSCMGNGLLGK------QD 120

Mouse   132 GRWYKQRKVMDLAFSRSSLVSLMETFNEKAEQLVEILEAKAD-GQTPVSMQDMLTCATIDILAKA 195
            ..|..:||..:.:|.:..|:|....|:.:.:.|:.:|:...| |:             ||::.:.
  Fly   121 PHWLDRRKHFNPSFKQDLLLSFFHIFDAETKVLMNLLDTYVDKGE-------------IDVVPEM 172

Mouse   196 AFGMETSMLLGAQKPLSQAVK--------VMLEGISA--SRNTLAKFMPGKRKQL---------- 240
               :..|..:.||..:...||        .::|...:  |.:||...||..:.::          
  Fly   173 ---LRWSFKIAAQTTMGSEVKHDEHFKNGSLVESFESLISHSTLNILMPLVQNRMISKICGYDKL 234

Mouse   241 -------------REIRESIRLLRQVGKD-----WVQRRREALKRGEDMPADILTQILKAEEGAQ 287
                         ..:.:.:..|.:...|     .:.|..|..::|     ||....:|:|    
  Fly   235 RADNFSRIQKMLDNVVNKKVNPLPKTDSDPESNIVINRAMELYRKG-----DITYMDVKSE---- 290

Mouse   288 DDEVLLDNFVTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVVGSKRH--LDYEDLGRL 350
                    ......||::|||..:...:..|:..||....:..|::.|.....|  :.|.|:.:|
  Fly   291 --------CCIMIAAGYDTSALTVYHALFLLANHPEHQEAVFEELNGVFPDAGHFGITYPDMQKL 347

Mouse   351 QYLSQVLKESLRLYPPAWGTFRLLEEET-LIDGVRVPGNTPL---LFSTYVMGRMDTYFEDPLTF 411
            .||.:|:||:|||.|....|.|..:.:. |.:||.:|....:   :|.|:  ...:.:..|...|
  Fly   348 DYLERVIKETLRLIPAIPITARETKNDVRLSNGVLIPKGVVIGIDMFHTH--RNPEVWGPDADNF 410

Mouse   412 NPDRF--GPGAPKPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQ 456
            |||.|  .....|..:.|.||:.|.|:|||.::|.|..|..:.::|:
  Fly   411 NPDNFLAENMEQKHPYAYIPFARGKRNCIGSKYAMMSSKFALCRILR 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp46a1NP_034140.1 p450 34..466 CDD:278495 98/470 (21%)
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 106/502 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.