DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp46a1 and Cyp4p2

DIOPT Version :9

Sequence 1:NP_034140.1 Gene:Cyp46a1 / 13116 MGIID:1341877 Length:500 Species:Mus musculus
Sequence 2:NP_610472.1 Gene:Cyp4p2 / 35946 FlyBaseID:FBgn0033395 Length:520 Species:Drosophila melanogaster


Alignment Length:375 Identity:94/375 - (25%)
Similarity:169/375 - (45%) Gaps:66/375 - (17%)


- Green bases have known domain annotations that are detailed below.


Mouse   133 RWYKQRKVMDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSMQDMLTCATIDILAKAAF 197
            :|:.:|.::...|....|....|.|  .||.|..:.:.:...:..||::|.::..|::.:.:.|.
  Fly   138 KWHTRRSMLTRTFHLDILNQFQEIF--IAESLKFVSQFQGQNEVVVSLKDRISRFTLNSICETAM 200

Mouse   198 GMETSMLLGAQK---------------------PL---------------SQAVKVMLEGISASR 226
            |::...:  |:|                     ||               :.|:||:.|   .||
  Fly   201 GIKLDEM--AEKGDRYRANFHIIDEGLTRRIVNPLYWDDCVYNMFTGHKYNAALKVVHE---FSR 260

Mouse   227 NTLAKFMPGKRKQLREIRESIRLLRQVGKD--WVQRRREALKRGEDMPADILTQILKAEEGAQDD 289
            ..:||    :|..|.|..|:.|..:....|  .::::|.|:         :.|.|...::|..||
  Fly   261 EIIAK----RRVLLEEELENRRATQTADDDICVIRKKRFAM---------LDTLICAEKDGLIDD 312

Mouse   290 EVLLDNFVTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDE-VVGSKRHLDYEDLGRLQYL 353
            ..:.:...|....|::|::..|.|.:|.:|...........|:.| ::....:|:...|.:|.||
  Fly   313 IGISEEVDTLMAEGYDTTSIGLVFGLMNMSLYAAEQELCYQEIQEHILDDLSNLNLSQLSKLNYL 377

Mouse   354 SQVLKESLRLYP--PAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRF 416
            ...:||::||||  |..|. :.|:|..|.:|:.:|..:.:....:.:.|...|:|.|..|.|:||
  Fly   378 GYFIKETMRLYPSIPIMGR-QTLQETELENGLILPKRSQINIHVFDIHRNPKYWESPEEFRPERF 441

Mouse   417 GPGAPKPR--FTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRIEFRLVP 464
            .|.....|  :.|.|||.|.|:||||::|..|:|.:|..:|:  .|:::|
  Fly   442 LPQNCLKRHPYAYIPFSAGQRNCIGQKYAMQEMKTLMVVILK--HFKILP 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp46a1NP_034140.1 p450 34..466 CDD:278495 94/375 (25%)
Cyp4p2NP_610472.1 p450 63..514 CDD:299894 94/375 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.