DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp46a1 and Cyp4ac3

DIOPT Version :9

Sequence 1:NP_034140.1 Gene:Cyp46a1 / 13116 MGIID:1341877 Length:500 Species:Mus musculus
Sequence 2:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster


Alignment Length:540 Identity:122/540 - (22%)
Similarity:219/540 - (40%) Gaps:143/540 - (26%)


- Green bases have known domain annotations that are detailed below.


Mouse     5 LLLLGSAVLLA---------------FGLCCTFVHRAR--------SRYEHIPGPPR-------- 38
            :.||||::|:.               ..||    .|.|        |:...:||..|        
  Fly     3 IALLGSSLLIGALWLLLRQLNKTYFILSLC----KRVRTADGSPLESKVFVVPGKTRFGNNLDLL 63

Mouse    39 ---PSFLLGHL----------PYFWKKDEDCGRVLQDVFLDWAKKYGPVVRVNVFYKTSVIVTSP 90
               |:.:..::          .|.|.            || :|.:|. :||.             
  Fly    64 NLTPANIFSYIRESTAKANGQNYIWN------------FL-FAPEYN-IVRA------------- 101

Mouse    91 ESVKKFLMSTKYNKDSKMYRALQTVFGERLFGQGLVSECDYGRWYKQRKVMDLAFSRSSLVSLME 155
            |..::...|||....:..|..::...|:     ||:...|. :|:.:||.:..||..:.|.|.:.
  Fly   102 EDAEEIFQSTKITTKNMSYELIRPFLGD-----GLLISIDQ-KWHTRRKTLTPAFHFNILQSFLS 160

Mouse   156 TFNEKAEQLVEILEAKADGQTPVSMQDMLTCATIDILAKAAFGMETSMLLGAQKPLSQAVKVMLE 220
            .|.|::::.::||:.....:  :.:..::...|::.:.:.|.|::              :..|.|
  Fly   161 IFKEESKKFIKILDKNVGFE--LELNQIIPQFTLNNICETALGVK--------------LDDMSE 209

Mouse   221 GISASRNTLAK------------------------FMPGKRKQLREIRESIRLLRQVGKDWVQRR 261
            |     |...|                        |:.|..|:...|   :|.:.......:||:
  Fly   210 G-----NEYRKAIHDFEIVFNQRMCNPLMFFNWYFFLFGDYKKYSRI---LRTIHGFSSGIIQRK 266

Mouse   262 REALKR---------GEDMPADILTQILKAE-EGAQDDEVLLDNFVTFFIAGHETSANHLAFTVM 316
            |:..|:         |:.....:|..:|.|| ||..|.:.:.|...||...|::|::..|.||::
  Fly   267 RQQFKQKQLGQVDEFGKKQRYAMLDTLLAAEAEGKIDHQGICDEVNTFMFGGYDTTSTSLIFTLL 331

Mouse   317 ELSRQPEIVARLQAEVDEVVGSKRHLDYEDLGRLQYLSQVLKESLRLYPPAWGTFRLLEEETLID 381
            .|:...::..|...|:.::......:.......|.:|..|:||||||:|.|....|...||::::
  Fly   332 LLALHADVQERCYEELQDLPEDIDEVSMFQFNELIHLECVIKESLRLFPSAPIIGRTCIEESVMN 396

Mouse   382 GVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGP--GAPKPRFTYFPFSLGHRSCIGQQFAQ 444
            |:.:|.|..:....|.:.|...:|..|..|.|:||.|  ...:..|.:.|||.|.|:||||:|..
  Fly   397 GLVLPKNAQISIHIYDIMRDARHFPKPNQFLPERFLPENSVNRHPFAFVPFSAGPRNCIGQKFGV 461

Mouse   445 MEVKVVMAKLLQRIEFRLVP 464
            :|:||::|.:::  .|:|:|
  Fly   462 LEIKVLLAAVIR--NFKLLP 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp46a1NP_034140.1 p450 34..466 CDD:278495 112/488 (23%)
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 112/488 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.