DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp46a1 and Cyp4s3

DIOPT Version :9

Sequence 1:NP_034140.1 Gene:Cyp46a1 / 13116 MGIID:1341877 Length:500 Species:Mus musculus
Sequence 2:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster


Alignment Length:494 Identity:135/494 - (27%)
Similarity:222/494 - (44%) Gaps:70/494 - (14%)


- Green bases have known domain annotations that are detailed below.


Mouse     8 LGSAVLLAFGLCCTFVH---------RARSRYEHIPGPPRPSFLLGHLPYFWKKDEDCGRVLQDV 63
            :.:..|:||.|...|:.         |.:...:.:|||     .:|.|....||.|         
  Fly     1 MSTLALVAFVLWAAFLRYLPKILNFLRLQRFAKTLPGP-----TIGELIANVKKGE--------- 51

Mouse    64 FLDWAK----KYGPVVRVNVFYKTSVIVTSPESVKKFLMSTKYNKDSKMYRALQTVFGERLFGQG 124
            .|:|.|    |:|||.|:.......|:.|.||.:|:.|.:.:....|:.|..|:...|:.|...|
  Fly    52 ILNWLKELREKHGPVFRIWFGKDLMVMFTDPEDIKQLLGNNQLLTKSRNYELLEPWLGKGLLTNG 116

Mouse   125 LVSECDYGRWYKQRKVMDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSMQDMLTCATI 189
            ..|      |:::||::...|....|....|...|....||..|..||:|:: ..:...:|...:
  Fly   117 GES------WHRRRKLLTPGFHFRILSEFKEPMEENCRILVRRLRTKANGES-FDIYPYITLFAL 174

Mouse   190 DILAKAAFGMETSMLLGAQKPLSQAV----KVMLEGISASRNTLAKFM----PGKRKQ--LREIR 244
            |.:.:.|.|::....|.:.....|||    :||.:...:....|..|.    |||.::  |:.:.
  Fly   175 DAICETAMGIKKHAQLQSDSEYVQAVQSICRVMHKQSFSFWQRLNVFFKHTKPGKEREAALKVLH 239

Mouse   245 -ESIRLLRQVGKDWVQRRREALKRGE--DMPAD---------ILTQILKAEEGAQ-DDEVLLDNF 296
             |:.|::|...:..:|.|.|.....|  |:.|.         :|||:   |.||: .|..:.:..
  Fly   240 DETNRVIRLRREQLIQERNEWKPEAEQDDVGAKRRLAFLDMLLLTQM---EGGAELSDTDIREEV 301

Mouse   297 VTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVVGSKRHLDYEDLGRLQYLSQVLKESL 361
            .||...||:|:::.:||.:..||:.|::..|...|..|:.|.::.       .:.||..|:||:|
  Fly   302 DTFMFEGHDTTSSAIAFALSLLSKNPDVQQRAFEEASELEGREKE-------SMPYLEAVIKETL 359

Mouse   362 RLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGAPKPR-F 425
            |:||......|.:.|:..:..:.||....:....|::.|....|.||..|:||||.....:.. |
  Fly   360 RIYPSVPFFSRKVLEDLEVGKLTVPKGASISCLIYMLHRDPKNFPDPERFDPDRFLVNEKQMHPF 424

Mouse   426 TYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRIEFRLVP 464
            .:..||.|.|:||||:||.:|:|..:|.||:  .:|.:|
  Fly   425 AFAAFSAGPRNCIGQKFAMLELKTSLAMLLR--SYRFLP 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp46a1NP_034140.1 p450 34..466 CDD:278495 129/459 (28%)
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 129/460 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.