DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp46a1 and Cyp318a1

DIOPT Version :9

Sequence 1:NP_034140.1 Gene:Cyp46a1 / 13116 MGIID:1341877 Length:500 Species:Mus musculus
Sequence 2:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster


Alignment Length:418 Identity:101/418 - (24%)
Similarity:186/418 - (44%) Gaps:68/418 - (16%)


- Green bases have known domain annotations that are detailed below.


Mouse   133 RWYKQRKVMDLAFSRSSLVSLMETFNEKAEQLVEILEAKAD--GQTP--VSMQDMLTCATIDILA 193
            :|..:||.::.|||.:.:.|..:.||....|:||..:.:.:  ||..  .:.:|:|:.|.:::..
  Fly   122 KWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTNLHGQAVKFTAAEDLLSRAVLEVSC 186

Mouse   194 KAAFGMETSMLLGAQKPLSQAVKVMLEGISASR------------NTLAKFMPGKRKQLREIRES 246
            ....|..|:........::.:.|.:|| |||.|            ..||..:..:.|:..::.|.
  Fly   187 LTIMGTPTNFTQLDDAHIAHSYKRLLE-ISAVRVVKPWLQIRLLHRLLAPELYEESKKCAKLLED 250

Mouse   247 I--RLLRQVGKDWVQRRREAL---KRGEDMPAD-----ILTQILK-AEEGAQDDEVLLDNFVTFF 300
            .  .::|...::|  |.|:|:   |.|||....     .:.||.: |..|....|.::|...:..
  Fly   251 FVGGIVRTKHRNW--RLRDAVGGEKSGEDASNGWQRRIFIEQIFQLAANGEMTLEEIMDEAQSMV 313

Mouse   301 IAGHETSANHLAFTVMEL-SRQPEIVARLQAEVDEVVGSKRHLDYEDLGRLQYLSQVLKESLRLY 364
            :...||.:|.:...::.| :.:.:...||.||:..:|.....:..|.|.:|:||...:.|||||.
  Fly   314 LVSFETVSNSIMLALLCLATNKGDCQRRLLAEIRALVPDVGQVGLEQLQQLRYLDAFVSESLRLL 378

Mouse   365 PPAWGTFRLLEEETLIDGVR----VPGNTPLLFSTYVMGRMDTYF-EDPLTFNPDRF-------- 416
            .......|.:..:..:.|.:    ||.|:.::..|:.|.|.:.:: .:...|:|.||        
  Fly   379 ATVPMNLRHVSRDFRLAGRQHETIVPQNSIVVLDTFNMQRDERWWGANARQFDPQRFLDQEEEQL 443

Mouse   417 -------GPGAPKPR------FTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRIEFRLVPGQRF 468
                   |.|..:.:      :::.|||.|.|||||:::....:||.:.||:...:|:    ..|
  Fly   444 SKGHNDSGSGEKRRQRDRRHSYSFLPFSNGLRSCIGRRYGLFIMKVFLVKLITNFDFQ----SDF 504

Mouse   469 GLQ-----EQATL--KPLDPVLCTLRPR 489
            .|:     |..:|  |..|.:|.|::|:
  Fly   505 ELEKLQFVENISLKFKNADDILLTIQPK 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp46a1NP_034140.1 p450 34..466 CDD:278495 92/386 (24%)
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 92/387 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.