DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp3a13 and Cyp6a20

DIOPT Version :9

Sequence 1:NP_031845.1 Gene:Cyp3a13 / 13113 MGIID:88610 Length:503 Species:Mus musculus
Sequence 2:NP_611002.3 Gene:Cyp6a20 / 36664 FlyBaseID:FBgn0033980 Length:501 Species:Drosophila melanogaster


Alignment Length:518 Identity:163/518 - (31%)
Similarity:265/518 - (51%) Gaps:53/518 - (10%)


- Green bases have known domain annotations that are detailed below.


Mouse     9 METWMLLATSLVLLYLYGTHSH-GIFKKLGIPGPKP-LPFLGTILAYQKGFWECDIQCHKKYGKM 71
            |...::|...::....:..|.| ..:|:.|||..:| :|: |......|.....|| ..:.|.|:
  Fly     1 MAVMIVLLIGVITFVAWYVHQHFNYWKRRGIPHDEPKIPY-GNTSELMKTVHFADI-FKRTYNKL 63

Mouse    72 WGLYDGR--------QPVLAITDPDIIKTVLVKECYSTFTNR-----RRFGPVGILKKAISISEN 123
            ....||.        :.::.:||.|..||||::| :..|.:|     .|..|:.  ...::| :.
  Fly    64 RNKTDGPFVGFYMYFKRMVVVTDIDFAKTVLIRE-FDKFHDRGVFHNERDDPLS--ANLVNI-DG 124

Mouse   124 EEWKRIRALLSPTFTSGRLKEMFPIINQFTDVLVRNMRQ-GLGEGKPTSMKDIFGAYSMDVITAT 187
            ::||.:|..|:||||||::|.|||.|....|.|:|...: ...:.....:.::...::.|||.:.
  Fly   125 QKWKTLRQKLTPTFTSGKMKTMFPTILTVGDELIRVFGETASADSDSMEITNVVARFTADVIGSC 189

Mouse   188 SFGVNIDSLNNPQDPFVEKIKKLL------KFDIFDPLFLSVTLFPFLTPVFDA-LNVSLFPRDV 245
            :||::..||::|:..||:.....:      |         |:.|..|..|...| |.:....::|
  Fly   190 AFGLDCHSLSDPKAKFVQMGTTAITERRHGK---------SMDLLLFGAPELAAKLRMKATVQEV 245

Mouse   246 ISFFTTSVERMKENRMKEKEKQRVDFLQLMINSQ-NYKTKESHKALSDVEIVAQSVIFIFAGYET 309
            ..|:...:....:.|:|...| |.||:.::|..: .:...:....|:..||.||:.||..||:||
  Fly   246 EDFYMNIIRDTVDYRVKNNVK-RHDFVDMLIEMKLKFDNGDKENGLTFNEIAAQAFIFFLAGFET 309

Mouse   310 TSSALSFALYLLAIHPDVQKKLQDEIDAAL-PNKAPATYDTLLQMEYLDMVVNETLRLYPIAGRL 373
            :|:.:.||||.||.|.|:|.||:.||:..| .:.....||::.:|.||:.|::||:|..|:.|.|
  Fly   310 SSTTMGFALYELACHQDIQDKLRTEINTVLKQHNGKLDYDSMREMTYLEKVIDETMRKRPVVGHL 374

Mouse   374 ERVC-----KTDVEINGLFIPKGTVVMIPTFALHKDPKYWPEPEEFRPERFSKKNQDSINPYMYL 433
            .||.     .|:.:.|   |.|||.|::||.|:|.||:::||||:|.||||.:..........:|
  Fly   375 IRVATQHYQHTNPKYN---IEKGTGVIVPTLAIHHDPEFYPEPEKFIPERFDEDQVQQRPACTFL 436

Mouse   434 PFGSGPRNCIGMRFALINMKVALVRVLQNFTVQ--PCKETEIPLKL-SKQGLLQPENPLLLKV 493
            |||.|||||||:||..:.:.|.:..::.||..:  |.| |.:||:. :...||..:..:.|||
  Fly   437 PFGDGPRNCIGLRFGRMQVIVGMALLIHNFKFEFHPTK-TVVPLEYRTDDFLLSSKGGIHLKV 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp3a13NP_031845.1 p450 39..491 CDD:365848 153/483 (32%)
Cyp6a20NP_611002.3 p450 32..496 CDD:278495 153/483 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0158
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.710

Return to query results.
Submit another query.