DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp3a13 and Cyp6t3

DIOPT Version :9

Sequence 1:NP_031845.1 Gene:Cyp3a13 / 13113 MGIID:88610 Length:503 Species:Mus musculus
Sequence 2:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster


Alignment Length:516 Identity:149/516 - (28%)
Similarity:247/516 - (47%) Gaps:60/516 - (11%)


- Green bases have known domain annotations that are detailed below.


Mouse    12 WMLLATSLVLLYLYGTHSHGIFKKLGIP-----GPKPLPFLGTILAYQKGFWECDIQCH----KK 67
            |:||.| :|.|..:..|.:..|:..|||     ...|:..||.:|..:..|.:...|.:    ..
  Fly     5 WLLLLT-IVTLNFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFLRISFGDLFRQLYADPRNG 68

Mouse    68 YGKMWGLYDGRQPVLAITDPDIIKTVLVKECYSTFTNRRRFG----PVGILKKAISISENEEWKR 128
            ..|:.|.:..:.|.|.:.||::|:.||:|. ::.|.||....    |:|.|  .:.:::...||.
  Fly    69 QAKIVGFFIFQTPALMVRDPELIRQVLIKN-FNNFLNRFESADAGDPMGAL--TLPLAKYHHWKE 130

Mouse   129 IRALLSPTFTSGRLKEMFPIINQFTDV---LVRNMRQGLGE--------GKPTSMKDIFGAYSMD 182
            .|..:|..|||||::::  :.:|..||   |.:.:.:.||:        |:...:      |:.|
  Fly   131 SRQCMSQLFTSGRMRDV--MYSQMLDVASDLEQYLNRKLGDRLERVLPLGRMCQL------YTTD 187

Mouse   183 VITATSFGVNIDSLNNPQDPFVEKIKKLLKFD---IFDPLFLSVTLFPFLTPVFDALNVSLFPRD 244
            |.....:.:|:..|...:...:.|.|:|...:   :.|  |:||...|..|.|   |...:|..|
  Fly   188 VTGNLFYSLNVGGLRRGRSELITKTKELFNTNPRKVLD--FMSVFFLPKWTGV---LKPKVFTED 247

Mouse   245 VISFFTTSVERMKENRMKEKEKQRVDFLQLMINSQNYKTKESHKALSDVEIVAQSVIFIFAGYET 309
            ...:....|:...|....:...|...| ||..:|.:|......       :.:|:.|.:.||:||
  Fly   248 YARYMRHLVDDHHEPTKGDLINQLQHF-QLSRSSNHYSQHPDF-------VASQAGIILLAGFET 304

Mouse   310 TSSALSFALYLLAIHPDVQKKLQDEIDAALPNKAPATYDTLLQMEYLDMVVNETLRLYPIAGRLE 374
            :|:.:.|.||.||..||:|::|:.|:..|..:.|..:||||:.:.||.||..|.|||||.|..:.
  Fly   305 SSALMGFTLYELAKAPDIQERLRSELREAFISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVN 369

Mouse   375 RVCKTDVEIN-------GLFIPKGTVVMIPTFALHKDPKYWPEPEEFRPERFSKKNQDSINPYMY 432
            |.|.:.....       ...:|.|....|....||:|.::||||..|.||||..:....|:|..|
  Fly   370 RECTSSASEGFSLQPHVDFIVPPGMPAYISILGLHRDERFWPEPCVFDPERFGPERSRHIHPMTY 434

Mouse   433 LPFGSGPRNCIGMRFALINMKVALVRVLQNFTVQPCKETEIPLKLS-KQGLLQPENPLLLK 492
            :|||:||..|||.|..::.:|:.:|.:|:.:.|:.|:.|...::.: |..:|:.||.:.|:
  Fly   435 IPFGAGPHGCIGSRLGVLQLKLGIVHILKQYWVETCERTVSEIRFNPKSFMLESENEIYLR 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp3a13NP_031845.1 p450 39..491 CDD:365848 138/486 (28%)
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 134/475 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.