DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp3a13 and Cyp4ac2

DIOPT Version :9

Sequence 1:NP_031845.1 Gene:Cyp3a13 / 13113 MGIID:88610 Length:503 Species:Mus musculus
Sequence 2:NP_608917.3 Gene:Cyp4ac2 / 33755 FlyBaseID:FBgn0031694 Length:511 Species:Drosophila melanogaster


Alignment Length:401 Identity:102/401 - (25%)
Similarity:203/401 - (50%) Gaps:36/401 - (8%)


- Green bases have known domain annotations that are detailed below.


Mouse   114 LKKAISISENEEWKRIRALLSPTFTSGRLKEMFPIINQFTDVLVRNMRQGLGEGKPTSMKDIFGA 178
            |.:.:.||.:::|...|..|:|.|....|:....|..:..:.||:.:.|.:  .....:..:...
  Fly   128 LGEGLLISTDQKWHSRRKALTPAFHFKVLQSFLIIFKEECNKLVKVLHQSV--NMELELNQVIPQ 190

Mouse   179 YSMDVITATSFGVNIDSLNN--PQDPFVEKIKKLLKFDIFDPLFLSVTLFPFLTPVF--DALNVS 239
            ::::.:..|:.||.:|.|:.  .....:..|:::::..:.:|.|.::..| ||...:  ...|:.
  Fly   191 FTLNNVCETALGVKLDDLSEGIRYRQSIHAIEEVMQQRLCNPFFYNIVYF-FLFGDYRKQVNNLK 254

Mouse   240 LFPRDVISFFTTSVER----MKENRMKEKE----KQRVDFLQLMINSQNYKTKESHKALSDVEIV 296
            :    ...|.:..:|:    .|.|::.:::    |||...|..::.::           :|.:|.
  Fly   255 I----AHEFSSNIIEKRRSLFKSNQLGQEDEFGKKQRYAMLDTLLAAE-----------ADGQID 304

Mouse   297 AQSV-----IFIFAGYETTSSALSFALYLLAIHPDVQKKLQDEIDAALPNKAPATYDTLLQMEYL 356
            .|.:     .|:|.||:|||:.|.|.|.:||:|.|||||..:||.....:....:.....::.|:
  Fly   305 HQGICDEVNTFMFEGYDTTSTCLIFTLLMLALHEDVQKKCYEEIKYLPDDSDDISVFQFNELVYM 369

Mouse   357 DMVVNETLRLYPIAGRLERVCKTDVEINGLFIPKGTVVMIPTFALHKDPKYWPEPEEFRPERFSK 421
            :.|:.|:|||:|....:.|.|..:..:|||.:||.|.:.|..:.:.:|.:::..|:.|:|:||..
  Fly   370 ECVIKESLRLFPSVPFIGRRCVEEGVVNGLIMPKNTQINIHLYEIMRDARHFSNPKMFQPDRFFP 434

Mouse   422 KNQDSINPYMYLPFGSGPRNCIGMRFALINMKVALVRVLQNFTVQPCKETEIPLKLSKQGLLQPE 486
            :|..:.:|:.::||.:|.|||||.:||::.:||.|..|::||.:.|....: .|......:|:.:
  Fly   435 ENTVNRHPFAFVPFSAGQRNCIGQKFAILEIKVLLAAVIRNFKILPVTLLD-DLTFENGIVLRTK 498

Mouse   487 NPLLLKVVSRD 497
            ..:.:|:|.|:
  Fly   499 QNIKVKLVHRE 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp3a13NP_031845.1 p450 39..491 CDD:365848 99/393 (25%)
Cyp4ac2NP_608917.3 p450 57..505 CDD:278495 99/395 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.