DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp3a13 and Cyp4ac1

DIOPT Version :9

Sequence 1:NP_031845.1 Gene:Cyp3a13 / 13113 MGIID:88610 Length:503 Species:Mus musculus
Sequence 2:NP_608916.1 Gene:Cyp4ac1 / 33754 FlyBaseID:FBgn0031693 Length:509 Species:Drosophila melanogaster


Alignment Length:407 Identity:108/407 - (26%)
Similarity:198/407 - (48%) Gaps:66/407 - (16%)


- Green bases have known domain annotations that are detailed below.


Mouse   114 LKKAISISENEEWKRIRALLSPTFTSGRLKEMFPIINQ----FTDVLVRNMRQGLGEGKPTSMKD 174
            |...:.||.:.:|...|..|:|.|....|:....|..:    |.:||.:|:...|      .:..
  Fly   127 LGDGLLISTDHKWHSRRKALTPAFHFNVLQSFLGIFKEECKKFLNVLEKNLDAEL------ELNQ 185

Mouse   175 IFGAYSMDVITATSFGVNIDSLN--NPQDPFVEKIKKLLKFDIFDPLFLSVTLFPFLTPVFDALN 237
            :...::::.|..|:.||.:|.::  |.....:..|:::|...:.:||.    .:.:...|:....
  Fly   186 VIPPFTLNNICETALGVKLDDMSEGNEYRKAIHAIEEVLIQRVCNPLM----YYNWYFFVYGDYR 246

Mouse   238 VSLFPRDVISFFTTSVERMKENRMKEKE---------KQRVDFLQLMINSQNYKTKESHKALSDV 293
            ..|....::..|::.:...|..:.::|:         |||...|..::.::           :|.
  Fly   247 KHLQNLRIVHDFSSRIIERKRQQFQQKQLGEVDEFGRKQRYAMLDTLLAAE-----------ADG 300

Mouse   294 EIVAQSV-----IFIFAGYETTSSALSFALYLLAIHPDVQKKLQDEIDAALPNKAPATYDTLLQM 353
            :|..|.:     .|:|.||:|||:.|.|.|.:||:|.|||||..:|::     ..|...|.:...
  Fly   301 QIDHQGICDEVNTFMFEGYDTTSTCLIFTLLMLALHEDVQKKCYEEVE-----NLPEDSDDISMF 360

Mouse   354 E-----YLDMVVNETLRLYPIAGRLERVCKTDVEINGLFIPKGTVVMIPTFALHKDPKYWPEPEE 413
            :     ||:.|:.|:||::|....:.|.|..:..:||:.:||.|.:.|..:.:.:||:::|:|:.
  Fly   361 QFNKLVYLECVIKESLRMFPSVPFIGRQCVEETVVNGMVMPKDTQISIHIYDIMRDPRHFPKPDL 425

Mouse   414 FRPERFSKKNQDSINPYMYLPFGSGPRNCIGMRFALINMKVALVRVLQNFTVQPCKETE------ 472
            |:|:||..:|..:.:|:.|:||.:|.|||||.:||::.|||.|..|::||.:.|..:.|      
  Fly   426 FQPDRFLPENTVNRHPFAYVPFSAGQRNCIGQKFAILEMKVLLAAVIRNFKLLPATQLEDLTFEN 490

Mouse   473 ---------IPLKLSKQ 480
                     |.:||||:
  Fly   491 GIVLRTQENIKVKLSKR 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp3a13NP_031845.1 p450 39..491 CDD:365848 108/407 (27%)
Cyp4ac1NP_608916.1 p450 86..504 CDD:278495 104/402 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.