DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp3a13 and Cyp28d1

DIOPT Version :9

Sequence 1:NP_031845.1 Gene:Cyp3a13 / 13113 MGIID:88610 Length:503 Species:Mus musculus
Sequence 2:NP_608912.1 Gene:Cyp28d1 / 33749 FlyBaseID:FBgn0031689 Length:502 Species:Drosophila melanogaster


Alignment Length:494 Identity:144/494 - (29%)
Similarity:245/494 - (49%) Gaps:56/494 - (11%)


- Green bases have known domain annotations that are detailed below.


Mouse    14 LLATSLVLLYLYGTHSHGIFKKLGIPGPKPLPFLGTI--LAYQKGFWECDI----QCHKKYGKMW 72
            ::|..|.|:|::.|.:...:||.|||..|..||:|:.  :..||.....||    :.:|....:.
  Fly    10 VIAAILALIYVFLTWNFSYWKKRGIPTAKSWPFVGSFPSVFTQKRNVVYDIDEIYEQYKNTDSIV 74

Mouse    73 GLYDGRQPVLAITDPDIIKTVLVKECYSTFTNR------RRFGPVGILKKAISISENEEWKRIRA 131
            |::..|.|.|.:|.|:....:.|.:..|...|.      .:..|  ||.....:...|.||..||
  Fly    75 GVFQTRIPQLMVTTPEYAHKIYVSDFRSFHDNEMAKFTDSKTDP--ILANNPFVLTGEAWKERRA 137

Mouse   132 LLSPTFTSGRLKEMFP----IINQFTDVLVRNMRQGLGEGKPTSMKDIFGAYSMDVITATSFGVN 192
            .::|..::.|:|..:|    :..:|.:.:.|.......:|  .:.||:...|:.:||:....|::
  Fly   138 EVTPGLSANRVKAAYPVSLRVCKKFVEYIRRQSLMAPAQG--LNAKDLCLCYTTEVISDCVLGIS 200

Mouse   193 IDSLNNPQDPFVEKIKKLLKFDIFDPLFLSV--TLFPFLTPVFDALNVSLFPRDVISFFTTSVER 255
            ..|..:...|.|...|::.: ..|..:|.:|  .|:|   |:....:||||.:||.:||...:::
  Fly   201 AQSFTDNPTPMVGMTKRVFE-QSFGFIFYTVVANLWP---PITKFYSVSLFAKDVAAFFYDLMQK 261

Mouse   256 -MKENRMKEKEKQRVDFLQLMINSQNYKTKESHKALSDVEIVAQSVIFIFAGYETTSSALSFALY 319
             ::..|.....:||.|||..|:..|      ..|.|:..|:.:.::.|:..|:|||:..|:..|.
  Fly   262 CIQVRRESPAAQQRDDFLNYMLQLQ------EKKGLNAAELTSHTMTFLTDGFETTAQVLTHTLL 320

Mouse   320 LLAIHPDVQKKLQDEIDAALPNKAPATYDTLLQMEYLDMVVNETLRLYPIAGRLERVCKTDVEI- 383
            .||.:|..|.||::||     ..|..|::.:.::.:.:..::||||::.......:|.....|: 
  Fly   321 FLARNPKEQMKLREEI-----GTAELTFEQISELPFTEACIHETLRIFSPVLAARKVVTEPCELT 380

Mouse   384 --NGLFIP--KGTVVMIPTFALHKDPKYWPEPEEFRPERF------SKKNQDSINPYMYLPFGSG 438
              ||:.:.  .|.||:||..|||.||:|:.||:.|:||||      :||.:|.   .::..||.|
  Fly   381 NKNGVSVKLRPGDVVIIPVNALHHDPQYYEEPQSFKPERFLNINGGAKKYRDQ---GLFFGFGDG 442

Mouse   439 PRNCIGMRFALINMKVALVRVLQNFTV----QPCKETEI 473
            ||.|.||||:|..:|.|||.:::||.:    :..|:.||
  Fly   443 PRICPGMRFSLTQIKAALVEIVRNFDIKVNPKTRKDNEI 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp3a13NP_031845.1 p450 39..491 CDD:365848 135/469 (29%)
Cyp28d1NP_608912.1 p450 35..477 CDD:278495 132/463 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0158
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.