DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp3a13 and Cyp4d2

DIOPT Version :9

Sequence 1:NP_031845.1 Gene:Cyp3a13 / 13113 MGIID:88610 Length:503 Species:Mus musculus
Sequence 2:NP_001284806.1 Gene:Cyp4d2 / 31192 FlyBaseID:FBgn0011576 Length:501 Species:Drosophila melanogaster


Alignment Length:491 Identity:150/491 - (30%)
Similarity:255/491 - (51%) Gaps:61/491 - (12%)


- Green bases have known domain annotations that are detailed below.


Mouse    13 MLLATSLVLL--YLYGTHSHGIFKKLGIPGPKPLPFLGTILAYQ----KGFWECDIQCHKKYGKM 71
            :|:|.:.:||  :|:....:||     :|||:||||||.:|.|:    :...:...:..:|||::
  Fly     9 LLVAFATLLLWDFLWRRRGNGI-----LPGPRPLPFLGNLLMYRGLDPEQIMDFVKKNQRKYGRL 68

Mouse    72 WGLYDGRQPVLAITDPDIIKTVLVKECYSTFTNRRRFGPVGILKKAIS--------ISENEEWKR 128
            :.::...|..:..|||..|:.||..:.:.|..|         |.|.::        :|...:|..
  Fly    69 YRVWILHQLAVFSTDPRDIEFVLSSQQHITKNN---------LYKLLNCWLGDGLLMSTGRKWHG 124

Mouse   129 IRALLSPTFTSGRLKEMFPIINQFTDVLVRNMRQGLGEGKPTSMKDIFGAYSMDVITATSFGVNI 193
            .|.:::|||....|::...|.:|.:.|:|..::.......|.::..:....::|:|..|:.|..|
  Fly   125 RRKIITPTFHFKILEQFVEIFDQQSAVMVEQLQSRADGMTPINIFPVICLTALDIIAETAMGTKI 189

Mouse   194 DSLNNPQDPFVEKIKKLLKFDI--FDPLFLSVTLFPFLTPVFDALNVSLFPRD----VISFFT-- 250
            ::..||..|:|:.:..:....|  |...:..|.....||...:|..     :|    |:..||  
  Fly   190 NAQKNPNLPYVQAVNDVTNILIKRFIHAWQRVDWIFRLTQPTEAKR-----QDKAIKVMHDFTEN 249

Mouse   251 -------TSVERMKENRMKEK-----EKQRVDFLQLMINSQNYKTKESHKALSDVEIVAQSVIFI 303
                   |.|...||...:|:     :|:|:..|.:::.|    |.:. ..|||.:|..:...|:
  Fly   250 IIRERRETLVNNSKETTPEEEVNFLGQKRRMALLDVLLQS----TIDG-APLSDEDIREEVDTFM 309

Mouse   304 FAGYETTSSALSFALYLLAIHPDVQKKLQDEIDAAL--PNKAPATYDTLLQMEYLDMVVNETLRL 366
            |.|::||:||:||.||.::.||:||::||.||...|  ..|:|.|...|.::::::.|:.|:|||
  Fly   310 FEGHDTTTSAISFCLYEISRHPEVQQRLQQEIRDVLGEDRKSPVTLRDLGELKFMENVIKESLRL 374

Mouse   367 YPIAGRLERVCKTDVEINGLFIPKGTVVMIPTFALHKDPKYWPEPEEFRPERFSKKNQDSINPYM 431
            :|....:.|....||||.|..||.||...:..|.|.:||:|:..|:|||||||. .:...|:||.
  Fly   375 HPPVPMIGRWFAEDVEIRGKHIPAGTNFTMGIFVLLRDPEYFESPDEFRPERFD-ADVPQIHPYA 438

Mouse   432 YLPFGSGPRNCIGMRFALINMKVALVRVLQNFTVQP 467
            |:||.:|||||||.:||::.||..:.::|::|.:.|
  Fly   439 YIPFSAGPRNCIGQKFAMLEMKSTVSKLLRHFELLP 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp3a13NP_031845.1 p450 39..491 CDD:365848 143/463 (31%)
Cyp4d2NP_001284806.1 p450 32..495 CDD:278495 143/463 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.