DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp3a11 and Cyp4e1

DIOPT Version :9

Sequence 1:NP_031844.1 Gene:Cyp3a11 / 13112 MGIID:88609 Length:504 Species:Mus musculus
Sequence 2:NP_524771.1 Gene:Cyp4e1 / 44632 FlyBaseID:FBgn0015034 Length:531 Species:Drosophila melanogaster


Alignment Length:533 Identity:138/533 - (25%)
Similarity:251/533 - (47%) Gaps:82/533 - (15%)


- Green bases have known domain annotations that are detailed below.


Mouse    12 WVLLA------ISLVLLYRYG--TRKHELFKKQGIPGPKPLPFLGT----------VLNYYKGLW 58
            |::|.      :.||..:..|  .||..|.|.|   ||..||.:|.          :||.:.|.|
  Fly     2 WIVLCAFLALPLFLVTYFELGLLRRKRMLNKFQ---GPSMLPLVGNAHQMGNTPTEILNRFFGWW 63

Mouse    59 KFDMECYKKYGK-TWGLFDGQTPLLAVTDPETIKNVLVKECF----SVFTNRRDFGPVGIMSKAI 118
                   .:||| .:..:.|....:.||:|:.::.:|..:..    .|:.....:..:|:::   
  Fly    64 -------HEYGKDNFRYWIGYYSNIMVTNPKYMEFILSSQTLISKSDVYDLTHPWLGLGLLT--- 118

Mouse   119 SISKDDEWKRYRALLSPTFTSGKLKEMFPVIEQYGDILVKYLRQKAKKGKPVTMKDVLGAYSMDV 183
              |...:|.::|.:::|.|....|::...|:.:.....:..|::.|..|.....::.....::||
  Fly   119 --STGSKWHKHRKMITPAFHFNILQDFHEVMNENSTKFIDQLKKVADGGNIFDFQEEAHYLTLDV 181

Mouse   184 ITSTSFGVNVDSLNNPEDPFVEKAKKL---LRFDFFDPLLFSVVLFPFLTPVYEMLNICMFPKDS 245
            |..|:.||:::::.|.....|:..|.:   ::...|.|...:..||.| .|.|...:..:  |..
  Fly   182 ICDTAMGVSINAMENRSSSVVQAFKDITYTIKMRAFSPWKRNKYLFHF-APEYPEYSKTL--KTL 243

Mouse   246 IEFFKKFVDRMKESR---------LDSKQKHRVDFLQLMMNSHNNSKDKVSHKALSDMEITAQSI 301
            .:|..:.:.:..|.|         .|...:.::.||..:::|      ||..:.|:..|:..:..
  Fly   244 QDFTNEIIAKRIEVRKSGLEVGIKADEFSRKKMAFLDTLLSS------KVDGRPLTSQELYEEVS 302

Mouse   302 IFIFAGYETTSSTLSFTLHSLATHPDIQKKLQDEIDEALPNKA---PPTYDTVMEMEYLDMVLNE 363
            .|:|.|::||:|.:.|.::.|:.|||.|:||.:|..:.:....   ..|:..:..|::||:.:.|
  Fly   303 TFMFEGHDTTTSGVGFAVYLLSRHPDEQEKLFNEQCDVMGASGLGRDATFQEISTMKHLDLFIKE 367

Mouse   364 TLRLYPIANRLERVCKKDVELNGVYIPKGSTVMIPSYALHHDPQHWSEPEEFQPERFSKENKGSI 428
            ..||||....:.|..:||..::|..:|||:|:.:....|.::.:.:.:|.:||||||.:|..|  
  Fly   368 AQRLYPSVPFIGRFTEKDYVIDGDIVPKGTTLNLGLLMLGYNDRVFKDPHKFQPERFDREKPG-- 430

Mouse   429 DPYVYLPFGNGPRNCLGMRFALMNMKLALTKIMQNFSFQPCKETQIPLKLSRQGL------LQP- 486
             |:.|:||..|||||:|.:|||:.:|..::||::||...|..:..:    |:.|.      ||| 
  Fly   431 -PFEYVPFSAGPRNCIGQKFALLEIKTVVSKIIRNFEVLPALDELV----SKDGYISTTLGLQPA 490

Mouse   487 EKPIVLKVVPRDA 499
            ||.      .|||
  Fly   491 EKK------SRDA 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp3a11NP_031844.1 p450 39..494 CDD:278495 125/491 (25%)
Cyp4e1NP_524771.1 p450 34..469 CDD:278495 118/461 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.