DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp3a11 and Cyp6a21

DIOPT Version :9

Sequence 1:NP_031844.1 Gene:Cyp3a11 / 13112 MGIID:88609 Length:504 Species:Mus musculus
Sequence 2:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster


Alignment Length:497 Identity:149/497 - (29%)
Similarity:250/497 - (50%) Gaps:34/497 - (6%)


- Green bases have known domain annotations that are detailed below.


Mouse     9 LETWVLLAISLVLLYRYGTRKHELFKKQGIPGPKPLPFLGTV-----LNYYKGLWKFDMECYKKY 68
            |.|.:|..:..:|:....|.:|  ::..|||..:|...:|::     ...:..:|......::..
  Fly     7 LLTALLALVGYLLMKWRSTMRH--WQDLGIPCEEPHILMGSMKGVRTARSFNEIWTSYYNKFRGS 69

Mouse    69 GKTWGLFDGQTPLLAVTDPETIKNVLVKECFSVFTNRRDF-----GPVGIMSKAISISKDDEWKR 128
            |...|.:..:.|.:.|.:....|.:|:|| |:.||:|..|     .|   :|..:.:....:|:.
  Fly    70 GPFAGFYWFRRPAVFVLETSLAKQILIKE-FNKFTDRGFFHNPEDDP---LSGQLFLLDGQKWRT 130

Mouse   129 YRALLSPTFTSGKLKEMFPVIEQYGDILVKYLRQKAKKGKPVTMKDVLGAYSMDVITSTSFGVNV 193
            .|..||.||||||:|.|||.:.:..:.......|...|...|.::::|..::.|||.:.:||:..
  Fly   131 MRNKLSSTFTSGKMKYMFPTVVKVANEFTDVFGQNVAKSPVVEVRELLARFTTDVIGTCAFGIEC 195

Mouse   194 DSLNNPEDPFVEKAKKLLRFDFFDPLLFSVV-LFPFLTPVYEMLNICMFPKDSIEFFKKFVDRMK 257
            .||.:|:..|.|..::.|......|:....| .||.|.   ..|::.|..:....||.:.|....
  Fly   196 SSLKDPDAEFREMGRRSLTEQRLGPVGIGFVNSFPNLA---RRLHMKMTAEPIERFFMRIVRETV 257

Mouse   258 ESRLDSKQKHRVDFLQLMMNSHN------NSKDKVSHKALSDMEITAQSIIFIFAGYETTSSTLS 316
            ..| :.....|.||:..:::..|      .|.:.|:   |:..||.||:.:|..||:||:|:|:.
  Fly   258 AFR-EQNNIRRNDFMDQLIDLKNKPLMVSQSGESVN---LTIEEIAAQAFVFFAAGFETSSTTMG 318

Mouse   317 FTLHSLATHPDIQKKLQDEIDEALPN-KAPPTYDTVMEMEYLDMVLNETLRLYPIANRLERVCKK 380
            |.|:.||.:.|||.:::.|..|.:.. .....|:::.::.|||.|::||||||.:...|.|.|.:
  Fly   319 FALYELAQNQDIQNRVRKECQEVIEKCNGELNYESMKDLVYLDQVVSETLRLYTVLPVLNRECLE 383

Mouse   381 DVELNG---VYIPKGSTVMIPSYALHHDPQHWSEPEEFQPERFSKENKGSIDPYVYLPFGNGPRN 442
            |.|:.|   ..|.||..|:||..|:|.|.:.::.|..|.|:.||.|.....|...:||||:||||
  Fly   384 DYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDNFSPERVKERDSVEWLPFGDGPRN 448

Mouse   443 CLGMRFALMNMKLALTKIMQNFSFQPCKETQIPLKLSRQGLL 484
            |:||||..|..::.|..::::|.|..|::|.||:..:::..|
  Fly   449 CIGMRFGQMQARIGLALLIKDFKFSVCEKTTIPMTYNKEMFL 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp3a11NP_031844.1 p450 39..494 CDD:278495 141/467 (30%)
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 141/467 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0158
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.720

Return to query results.
Submit another query.