DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNH8 and CngB

DIOPT Version :10

Sequence 1:XP_016861187.1 Gene:KCNH8 / 131096 HGNCID:18864 Length:1108 Species:Homo sapiens
Sequence 2:NP_611607.2 Gene:CngB / 37479 FlyBaseID:FBgn0266346 Length:1040 Species:Drosophila melanogaster


Alignment Length:72 Identity:15/72 - (20%)
Similarity:24/72 - (33%) Gaps:27/72 - (37%)


- Green bases have known domain annotations that are detailed below.


Human   118 MDGRMAKYWLPWLVGMPAETTIAIC-------------SMIMGGV-----------FEKFPKLKV 158
            :|||.....:|.|..:   .|:|.|             :..:|.:           .|||..|::
  Fly    29 LDGRDCSIEMPILKDV---ATVAFCDAQSTSEIHEKVLNEAVGALMWHTIILTKEDLEKFKALRI 90

Human   159 CFAHGGG 165
            ....|.|
  Fly    91 IVRIGSG 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNH8XP_016861187.1 PAS_9 40..135 CDD:463873 5/16 (31%)
PLN03192 175..>615 CDD:215625
PRK11753 578..>656 CDD:236969
CngBNP_611607.2 PLN03192 411..>891 CDD:215625
CAP_ED 775..889 CDD:237999
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.