DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp2a4 and spo

DIOPT Version :9

Sequence 1:NP_034127.2 Gene:Cyp2a4 / 13086 MGIID:88596 Length:494 Species:Mus musculus
Sequence 2:NP_001286943.1 Gene:spo / 38631 FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster


Alignment Length:533 Identity:137/533 - (25%)
Similarity:230/533 - (43%) Gaps:88/533 - (16%)


- Green bases have known domain annotations that are detailed below.


Mouse     6 LLLVAAVAFLSVL------VLMSVWKQRKLSGKL----------PPGPTPLPFVGN--FLQLNTE 52
            ||.|.|.:::.::      ||..|  :.|.|.::          .|||.|.|.:||  .|....:
  Fly    13 LLSVLATSYICIIYGVKRRVLQPV--KTKNSTEINHNAYQKYTQAPGPRPWPIIGNLHLLDRYRD 75

Mouse    53 QMYNSLMKISQRYGPVFTIYLGSRRIVVLCGQETVKEALVDQAEEFSGRGEQATFDWLFKG---Y 114
            ..:.....::|:||.::::..|..|.:|:...|.::|.|....:..|||.:...:..||.|   .
  Fly    76 SPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKVMSGRPDFIRYHKLFGGERSN 140

Mouse   115 GIAFSSGERAKQLRR-----------FSITTLRDFGVGKRGIEERIQEEAGFLIDSFRKTNGAFI 168
            .:|.....:.:|.||           ||...::...:|...:|...:|....|:.      |..|
  Fly   141 SLALCDWSQLQQKRRNLARRHCSPREFSCFYMKMSQIGCEEMEHWNRELGNQLVP------GEPI 199

Mouse   169 DPTFYLSRTVSNVISSIVFGDRFDYEDKEFLSLLRMMLGSLQFTATSMGQVYE----MFSSVMKH 229
            :....:.:..:|:.|..:...||||:|.:|..:::..  ...|...:.|...:    ::....:|
  Fly   200 NIKPLILKACANMFSQYMCSLRFDYDDVDFQQIVQYF--DEIFWEINQGHPLDFLPWLYPFYQRH 262

Mouse   230 LPGPQQQAFKELQGLEDFITKK-VEHNQRTLDPNSP-RDFIDSFLIRMLEEKKNPNTEFYMKNLV 292
            |    .:.......:..||.:: :.|.:.::|.:.| |||.|:.|..:||:|.      ..:|.:
  Fly   263 L----NKIINWSSTIRGFIMERIIRHRELSVDLDEPDRDFTDALLKSLLEDKD------VSRNTI 317

Mouse   293 LTTLNLFFAGTETVSTTLRYGFLLLMKYPDIEAKVHEEIDRVI-GRNRQPKYEDRMKMPYTEAVI 356
            :..|..|..|...|...:......:.|..||..::.||||.:| ..||.....|...||||.|.|
  Fly   318 IFMLEDFIGGHSAVGNLVMLVLAYIAKNVDIGRRIQEEIDAIIEEENRSINLLDMNAMPYTMATI 382

Mouse   357 HEIQRFAD--LIPMGLARRVTKDTKFRDFLLPKGTEVFPMLGSVLKDPKFFSNPKDFNPKHFLD- 418
            .|:.|::.  ::|    ...|:||....:.:.|||.||.....:....||:.|||:|||..||: 
  Fly   383 FEVLRYSSSPIVP----HVATEDTVISGYGVTKGTIVFINNYVLNTSEKFWVNPKEFNPLRFLEP 443

Mouse   419 --------------------DKGQFKKS-DAFVPFSIGKRYCFGEGLARMELFLFLTNIMQNFHF 462
                                :|.|.|:: ..|:|||||||.|.|:.|.|...||.:.|:||.::.
  Fly   444 SKEQSPKNSKGSDSGIESDNEKLQLKRNIPHFLPFSIGKRTCIGQNLVRGFGFLVVVNVMQRYNI 508

Mouse   463 KSTQEPQDIDVSP 475
             |:..|..|.:||
  Fly   509 -SSHNPSTIKISP 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp2a4NP_034127.2 p450 34..491 CDD:278495 128/489 (26%)
spoNP_001286943.1 p450 56..540 CDD:299894 128/488 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.