DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp19a1 and Cyp4ac3

DIOPT Version :9

Sequence 1:NP_001335100.1 Gene:Cyp19a1 / 13075 MGIID:88587 Length:503 Species:Mus musculus
Sequence 2:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster


Alignment Length:382 Identity:91/382 - (23%)
Similarity:176/382 - (46%) Gaps:40/382 - (10%)


- Green bases have known domain annotations that are detailed below.


Mouse   141 WRTIRPFFMKALTGPGLVRMVEVCVESIKQHLDRLGEVTDTS-GY-VDVLTLMRHIMLDTSNMLF 203
            |.|.|    |.||......:::..:...|:...:..::.|.: |: :::..::....|:......
  Fly   139 WHTRR----KTLTPAFHFNILQSFLSIFKEESKKFIKILDKNVGFELELNQIIPQFTLNNICETA 199

Mouse   204 LGIPLDE----SAIVKKIQGYFNAWQALLIKPNIFFKISWL------YRKYERSVKDLKDEIAVL 258
            ||:.||:    :...|.|..:...:...:..|.:||  :|.      |:||.|.::.:....:.:
  Fly   200 LGVKLDDMSEGNEYRKAIHDFEIVFNQRMCNPLMFF--NWYFFLFGDYKKYSRILRTIHGFSSGI 262

Mouse   259 VEKKRHKVSTAEKLEDCMDFA--------TDLIFAERRGDLTKENVNQCILEMLIAAPDTMSVTL 315
            :::||.:.. .::|....:|.        ..|:.||..|.:..:.:...:...:....||.|.:|
  Fly   263 IQRKRQQFK-QKQLGQVDEFGKKQRYAMLDTLLAAEAEGKIDHQGICDEVNTFMFGGYDTTSTSL 326

Mouse   316 YFMLLLVAEYPEVEAAILKEIHTVVGDRD-IKIEDIQNLKVVENFINESMRYQPVVDLVMRRALE 379
            .|.|||:|.:.:|:....:|:..:..|.| :.:.....|..:|..|.||:|..|...::.|..:|
  Fly   327 IFTLLLLALHADVQERCYEELQDLPEDIDEVSMFQFNELIHLECVIKESLRLFPSAPIIGRTCIE 391

Mouse   380 DDVIDGYPVKKGTNIILNI-GRMHRLEYFPKPNEFTLENF--EKNV---PYRYFQPFGFGPRGCA 438
            :.|::|..:.|...|.::| ..|....:|||||:|..|.|  |.:|   |:. |.||..|||.|.
  Fly   392 ESVMNGLVLPKNAQISIHIYDIMRDARHFPKPNQFLPERFLPENSVNRHPFA-FVPFSAGPRNCI 455

Mouse   439 GKYIAMVMMKVVLVTLLRRFQVKTLQKRCIENIPKKNDLSLHPNEDRHLVEIIFSPR 495
            |:...::.:||:|..::|.|  |.|....:|::..:|.:.|...::   :::.|..|
  Fly   456 GQKFGVLEIKVLLAAVIRNF--KLLPATQLEDLTFENGIVLRTQQN---IKVKFEAR 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp19a1NP_001335100.1 p450 48..488 CDD:306555 89/373 (24%)
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 89/377 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845356
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24291
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.