DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp19a1 and Cyp318a1

DIOPT Version :9

Sequence 1:NP_001335100.1 Gene:Cyp19a1 / 13075 MGIID:88587 Length:503 Species:Mus musculus
Sequence 2:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster


Alignment Length:438 Identity:96/438 - (21%)
Similarity:179/438 - (40%) Gaps:81/438 - (18%)


- Green bases have known domain annotations that are detailed below.


Mouse   116 FGSKRGLQCIGMHENGIIF-----NNNPSLWRTIRPFFMKALTGPGLVRMVEVCVESIKQHLDRL 175
            |..:|||    :|..|..:     ..||:....|...|.......|     ...||..:...:..
  Fly   109 FFVRRGL----LHARGQKWKLRRKQLNPAFSHNIVASFFDVFNSVG-----NQMVEQFQTQTNLH 164

Mouse   176 GEVTDTSGYVDVLTLMRHIMLDTSNMLFLGIP-----LDESAIVKKIQGYFNAWQALLIKPNIFF 235
            |:....:...|:|:   ..:|:.|.:..:|.|     ||::.|....:.........::||.:..
  Fly   165 GQAVKFTAAEDLLS---RAVLEVSCLTIMGTPTNFTQLDDAHIAHSYKRLLEISAVRVVKPWLQI 226

Mouse   236 KI------SWLYRKYERSVKDLKDEIAVLVEKK------RHKVSTAEKLEDCMDFATDLIFAER- 287
            ::      ..||.:.::..|.|:|.:..:|..|      |..|...:..||..:.....||.|: 
  Fly   227 RLLHRLLAPELYEESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQRRIFIEQI 291

Mouse   288 -----RGDLTKENVNQCILEMLIAAPDTMSVTLYFMLL-LVAEYPEVEAAILKEIHTVVGD-RDI 345
                 .|::|.|.:......|::.:.:|:|.::...|| |.....:.:..:|.||..:|.| ..:
  Fly   292 FQLAANGEMTLEEIMDEAQSMVLVSFETVSNSIMLALLCLATNKGDCQRRLLAEIRALVPDVGQV 356

Mouse   346 KIEDIQNLKVVENFINESMRYQPVVDLVMRRALEDDVIDGYP----VKKGTNIILNIGRMHRLEY 406
            .:|.:|.|:.::.|::||:|....|.:.:|....|..:.|..    |.:.:.::|:...|.|.|.
  Fly   357 GLEQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLAGRQHETIVPQNSIVVLDTFNMQRDER 421

Mouse   407 FPKPN--EFTLENF----------------------EKNVPYRY-FQPFGFGPRGCAGKYIAMVM 446
            :...|  :|..:.|                      :::..:.| |.||..|.|.|.|:...:.:
  Fly   422 WWGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLPFSNGLRSCIGRRYGLFI 486

Mouse   447 MKVVLVTLLRRFQVKT---LQK-RCIENIPKK----ND--LSLHPNED 484
            |||.||.|:..|..::   |:| :.:|||..|    :|  |::.|.::
  Fly   487 MKVFLVKLITNFDFQSDFELEKLQFVENISLKFKNADDILLTIQPKKE 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp19a1NP_001335100.1 p450 48..488 CDD:306555 96/438 (22%)
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 87/405 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.