DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CPO and CG32379

DIOPT Version :9

Sequence 1:NP_775100.1 Gene:CPO / 130749 HGNCID:21011 Length:374 Species:Homo sapiens
Sequence 2:NP_729252.2 Gene:CG32379 / 326211 FlyBaseID:FBgn0052379 Length:344 Species:Drosophila melanogaster


Alignment Length:329 Identity:102/329 - (31%)
Similarity:175/329 - (53%) Gaps:13/329 - (3%)


- Green bases have known domain annotations that are detailed below.


Human    26 AQHRQEIVDKSVSPW-SLETYSYNIYHPMGEIYEWMREISEKYKEVVTQHFLGVTYETHPMYYLK 89
            ||..:.:..|.:..| .::..|  .::...||.:::..:.|::.:.|.....|.:||..|:..|.
  Fly    21 AQRAENLRKKLLIQWPHIDVLS--AFYTHSEINDYLDSLLERFPKRVQVKQFGWSYERRPLKVLT 83

Human    90 ISQPSGNPKK-IIWMDCGIHAREWIAPAFCQWFVKEILQNHKDNSSIRKLLRNLDFYVLPVLNID 153
            |:...|...| :|.:|..:||||||:|:...:.::::|.|:.||   ::||::.|:.::||:|.|
  Fly    84 ITNGDGRRNKPVILIDGTVHAREWISPSMALYIIQQLLDNYGDN---QELLQDYDWVIMPVVNAD 145

Human   154 GYIYTWTTDRLWRKSRSPHNNGTCFGTDLNRNFNASW-CSIGASRNCQDQTFCGTGPVSEPETKA 217
            ||.||.|..|.|||||.|.:|..|.|||:||||...| ...|:|.:..:..:.|..|..:.|::.
  Fly   146 GYEYTHTDSRYWRKSRRPTSNPECIGTDINRNFGYEWGHDEGSSSDPCENIYRGERPFDQSESQV 210

Human   218 VASFIESKKDDILCFLTMHSYGQLILTPYGYTKNKSSNHPEMIQVGQKAANALKAKYGTN--YRV 280
            :...:...|..:..:|::||||...|.|:|||.:....:.:|:.|....|.|:  .|.||  |..
  Fly   211 LRDVMLHYKGRLNFYLSLHSYGNYFLLPWGYTSDFPDTYQDMMSVADAGAKAI--IYSTNGIYSY 273

Human   281 GSSADILYASSGSSRDWARD-IGIPFSYTFELRDSGTYGFVLPEAQIQPTCEETMEAVLSVLDDV 344
            ||:..:||.:||.:.|:|.. :....:.|.||..:|..||....:||:....|:...|.::..:|
  Fly   274 GSTYYVLYPTSGDTTDFAFGVVNATVAMTMELPAAGFQGFDPWISQIERLVTESWVGVRAMAAEV 338

Human   345 YAKH 348
            ..::
  Fly   339 IRRY 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CPONP_775100.1 M14_CPO 47..344 CDD:133105 96/301 (32%)
CG32379NP_729252.2 M14_CP_A-B_like 44..338 CDD:199844 96/298 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157686
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.