DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp11b2 and Cyp12a5

DIOPT Version :9

Sequence 1:NP_034121.4 Gene:Cyp11b2 / 13072 MGIID:88584 Length:500 Species:Mus musculus
Sequence 2:NP_650782.1 Gene:Cyp12a5 / 42293 FlyBaseID:FBgn0038680 Length:536 Species:Drosophila melanogaster


Alignment Length:529 Identity:135/529 - (25%)
Similarity:232/529 - (43%) Gaps:100/529 - (18%)


- Green bases have known domain annotations that are detailed below.


Mouse    32 PKTLQ--PFEAIP----------------QYSRNKWLKMIQILREQGQENLHLEMHQVFRELGPI 78
            |:.||  |||.||                :|...:.::||..||:.....:.|.           
  Fly    39 PEWLQAKPFEEIPKANILSLFAKSALPGGKYKNLEMMEMIDALRQDYGNIIFLP----------- 92

Mouse    79 FRHSVGKTQIVSVMLPEDAEKLHQVESMLPRRMHLEPWVAHREL------RGLRRGVFLLNGPEW 137
              ..:|:..:|....|:|.|.:.:.|.:.|.|...:....||.:      .|: :|:....|..|
  Fly    93 --GMMGRDGLVMTHNPKDFEVVFRNEGVWPFRPGSDILRYHRTVYRKDFFDGV-QGIIPSQGKSW 154

Mouse   138 RLNRLRLNRNVLSPKAVQKFVPMVDMVARDFLETLKEKVLQNARGSLTMDVQ----QSLFNYTIE 198
            ...|..:|..::.||.|:.:...:..|.::|:|.:||     .|.:.|.:|.    :::..:|:|
  Fly   155 GDFRSIVNPVLMQPKNVRLYFKKMSQVNQEFVELIKE-----IRDASTQEVPGNFLETINRWTLE 214

Mouse   199 ASNFALFGERLGLLGHD-LSPGSLKFIHALHSMFKSTSQLLFLPKSLTRWTSTRVWKEHFDAWDV 262
            :.:.....::||||... .:..:.|....|...|..::.|...| ||.|:..|.:.|:.....|.
  Fly   215 SVSVVALDKQLGLLRESGKNSEATKLFKYLDEFFLHSADLEMKP-SLWRYFKTPLLKKMLRTMDS 278

Mouse   263 ISE----YANRCIWKVHQELRLGSSQTYSGIV----AELISQGSLPLDAIKAN--SMELTAGSVD 317
            :.|    |.:..|.::.:|.:       .|:|    .:.:.:..|.:|...|.  :|::....||
  Fly   279 VQEVTLKYVDEAIERLEKEAK-------EGVVRPEHEQSVLEKLLKVDKKVATVMAMDMLMAGVD 336

Mouse   318 TTAIPLVMTLFELARNPDVQKALRQESLAAEASIAAN-----PQKAMSDLPLLRAALKETLRLYP 377
            ||:......|..||:||:.|..||:|.:    .:..|     .:.:|.::|.|||.:||:.|:||
  Fly   337 TTSSTFTALLLCLAKNPEKQARLREEVM----KVLPNKDSEFTEASMKNVPYLRACIKESQRVYP 397

Mouse   378 VGGFLERILSSDLVLQNYHVPAGTLVLLY----LYSMGRNPAVFPRPERYMPQRW---------- 428
            :.....|.|:.|.|:..|.|||||:|.:.    |||    ...||:|..::|:||          
  Fly   398 LVIGNARGLTRDSVISGYRVPAGTIVSMIPINSLYS----EEYFPKPTEFLPERWLRNASDSAGK 458

Mouse   429 -----LERKRSFQHLAFGFGVRQCLGRRLAEVEMMLLLHHILKTFQVETLRQEDVQMAYRFVLMP 488
                 |:.|..|..|.||||.|.|:|:|:.|:|:.|....:::.|.||.  ....:.|:|..|:.
  Fly   459 CPANDLKTKNPFVFLPFGFGPRMCVGKRIVEMELELGTARLIRNFNVEF--NHSTKNAFRSALIN 521

Mouse   489 SSSPVLTFR 497
            ..:..|.|:
  Fly   522 LPNIPLKFK 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp11b2NP_034121.4 p450 42..496 CDD:365848 127/514 (25%)
Cyp12a5NP_650782.1 p450 81..531 CDD:278495 124/487 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8705
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.