DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp11b2 and Cyp12c1

DIOPT Version :9

Sequence 1:NP_034121.4 Gene:Cyp11b2 / 13072 MGIID:88584 Length:500 Species:Mus musculus
Sequence 2:NP_001287109.1 Gene:Cyp12c1 / 40037 FlyBaseID:FBgn0036806 Length:524 Species:Drosophila melanogaster


Alignment Length:497 Identity:138/497 - (27%)
Similarity:232/497 - (46%) Gaps:66/497 - (13%)


- Green bases have known domain annotations that are detailed below.


Mouse    36 QPFEAIPQYSRNKWLKMIQILR--EQGQENLHLEMHQVFRELGPIFRHSVGKTQIVSVM--LP-- 94
            :||..:|..:|  |    |:.|  ::|.|...|.|..|.|    :::...|...::..:  :|  
  Fly    39 KPFTELPGPTR--W----QLFRGFQKGGEYHQLGMDDVMR----LYKKQFGDICLIPGLFGMPST 93

Mouse    95 ------EDAEKLHQVESMLPRRMHLEPWVAHRELR---------GLRRGVFLLNGPEWRLNRLRL 144
                  |..||:::.|...|.|...||.:.:|..|         ||     ..||.||..||..:
  Fly    94 VFTFNVETFEKVYRTEGQWPVRGGAEPVIHYRNKRKDEFFKNCMGL-----FGNGAEWGKNRSAV 153

Mouse   145 NRNVLSPKAVQKFVPMVDMVARDFLETLKE---KVLQNARGSLTMDVQQSLFNYTIEASNFALFG 206
            |..::..:.|..::..:..|.|.|:..::|   |..|...|    |...::.:.|.|:.......
  Fly   154 NPVLMQHRNVAIYLKPMQRVNRQFVNRIREIRDKESQEVPG----DFMNTINHLTFESVATVALD 214

Mouse   207 ERLGLLGH-DLSPGSLKFIHALHSMFKSTSQLLFLPKSLTRWTSTRVWKEHFDAWDVI----SEY 266
            ..||||.. :..|.:.|....:..:..|...|...| ||.|:..|..:|:...|.|.|    |.|
  Fly   215 RELGLLREANPPPEASKLFKNIEVLMDSFFDLGVRP-SLYRYIPTPTYKKFSRAMDEIFDTCSMY 278

Mouse   267 ANRCIWKVHQELRLGSSQTYSGIVAELISQGSLPLDAIKANSMELTAGSVDTTAIPLVMTLFELA 331
            .|:.|.::.::...|.|..:..::.:|: |....|..:.|  |::..|.||||:..:...|..||
  Fly   279 VNQAIERIDRKSSQGDSNDHKSVLEQLL-QIDRKLAVVMA--MDMLMGGVDTTSTAISGILLNLA 340

Mouse   332 RNPDVQKALRQESLAAEASIAAN-PQKAMSDLPLLRAALKETLRLYPVGGFLERILSSDLVLQNY 395
            :||:.|:.||:|.|:...|:.:. ..:.|..||.|||.:||:||||||.....|...:|:||..|
  Fly   341 KNPEKQQRLREEVLSKLTSLHSEFTVEDMKSLPYLRAVIKESLRLYPVTFGNARSAGADVVLDGY 405

Mouse   396 HVPAGTLVLLYLYSMGRNPAVFPRPERYMPQRWLERK-------------RSFQHLAFGFGVRQC 447
            .:|.||.:|:....:.::..::||.:.::|:|||.||             .:|.:|.||||.|.|
  Fly   406 RIPKGTKLLMTNSFLLKDDRLYPRAKEFIPERWLRRKDDDKSDVLMNKDLNAFIYLPFGFGPRMC 470

Mouse   448 LGRRLAEVEMMLLLHHILKTFQVETLRQEDVQMAYRFVLMPS 489
            :|:|:.::||.|.:.::::.|.:|.....:.....||:..|:
  Fly   471 VGKRIVDLEMELTVANLVRNFHIEYNYSTEKPYKCRFLYKPN 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp11b2NP_034121.4 p450 42..496 CDD:365848 136/491 (28%)
Cyp12c1NP_001287109.1 p450 45..502 CDD:278495 133/479 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8705
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.