DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp11b2 and shd

DIOPT Version :9

Sequence 1:NP_034121.4 Gene:Cyp11b2 / 13072 MGIID:88584 Length:500 Species:Mus musculus
Sequence 2:NP_001261843.1 Gene:shd / 39592 FlyBaseID:FBgn0003388 Length:540 Species:Drosophila melanogaster


Alignment Length:490 Identity:117/490 - (23%)
Similarity:211/490 - (43%) Gaps:56/490 - (11%)


- Green bases have known domain annotations that are detailed below.


Mouse    32 PKTLQPFEAIPQYSRNKWLKMIQILREQGQENLHLEMHQVFRELGPIFRHSV-GKTQIVSVMLPE 95
            ||.: ||..      .||:.:: ..|......||.....:.|:.|.|....: ....||.:...:
  Fly    65 PKRI-PFLG------TKWIFLL-FFRRYKMTKLHEVYADLNRQYGDIVLEVMPSNVPIVHLYNRD 121

Mouse    96 DAEKLHQVESMLPRRMHLEPWVAHRELRGLRR---GVFLLNGPEWRLNRLRLNRNVLSPKAVQKF 157
            |.||:.:..|..|.|...|..|.:|:.|..|.   |:....||.|:..|..|..::.||:.:|.|
  Fly   122 DLEKVLKYPSKYPFRPPTEIIVMYRQSRPDRYASVGIVNEQGPMWQRLRSSLTSSITSPRVLQNF 186

Mouse   158 VPMVDMVARDFLETLKEKVLQNARGSLTMDVQ--QSLFNYT-IEASNFALFGERLGLLGHDL-SP 218
            :|.::.|..||:|.|:.:     |...|:.|.  :.|.|.. :||....:.|.|:|.|..|. .|
  Fly   187 LPALNAVCDDFIELLRAR-----RDPDTLVVPNFEELANLMGLEAVCTLMLGRRMGFLAIDTKQP 246

Mouse   219 GSLKFIHALHSMFKSTSQLLFLPK-------SLTRWTSTRVWKEHFDAWDVISEYANRCIWKVHQ 276
            ..:       |...:..:.||:.:       .|.::..|:.:::...|.|:|.:..:..|....:
  Fly   247 QKI-------SQLAAAVKQLFISQRDSYYGLGLWKYFPTKTYRDFARAEDLIYDVISEIIDHELE 304

Mouse   277 ELRLGS------SQTYSGIVAELISQGSLPLDAIKANSMELTAGSVDTTAIPLVMTLFELARNPD 335
            ||:..:      :.....|...::....|.:...|:..::..|..::|.|..|:..|..:..:|.
  Fly   305 ELKKSAACEDDEAAGLRSIFLNILELKDLDIRDKKSAIIDFIAAGIETLANTLLFVLSSVTGDPG 369

Mouse   336 VQKALRQESLA-AEASIAANPQKAMSDLPLLRAALKETLRLYPVGGFLERILSSDLVLQNYHVPA 399
            ....:..|... .:.:|.   |.|:::....:|.::|:.||.|....|.|||..|:.|..|.:.|
  Fly   370 AMPRILSEFCEYRDTNIL---QDALTNATYTKACIQESYRLRPTAFCLARILEEDMELSGYSLNA 431

Mouse   400 GTLVLLYLYSMGRNPAVFPRPERYMPQRWLE-RKRSFQ--------HLAFGFGVRQCLGRRLAEV 455
            ||:||..........:.|...:::.|:||:: ...:|.        .:.||.|.|.|.|:|..|:
  Fly   432 GTVVLCQNMIACHKDSNFQGAKQFTPERWIDPATENFTVNVDNASIVVPFGVGRRSCPGKRFVEM 496

Mouse   456 EMMLLLHHILKTFQVETLRQEDVQMAYRFVLMPSS 490
            |::|||..::..|.|..::  .::..:.|:|.|.:
  Fly   497 EVVLLLAKMVLAFDVSFVK--PLETEFEFLLAPKT 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp11b2NP_034121.4 p450 42..496 CDD:365848 113/480 (24%)
shdNP_001261843.1 p450 63..528 CDD:299894 116/487 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.