DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp11b2 and Cyp12d1-d

DIOPT Version :9

Sequence 1:NP_034121.4 Gene:Cyp11b2 / 13072 MGIID:88584 Length:500 Species:Mus musculus
Sequence 2:NP_995812.1 Gene:Cyp12d1-d / 2768720 FlyBaseID:FBgn0053503 Length:521 Species:Drosophila melanogaster


Alignment Length:458 Identity:120/458 - (26%)
Similarity:195/458 - (42%) Gaps:80/458 - (17%)


- Green bases have known domain annotations that are detailed below.


Mouse    84 GKTQIVSVMLPEDAEKLHQVESMLPRRMHLEPWVAHRE-----LRGLRRGVFLLNGPEWRLNRLR 143
            |:...|:....:|.|.:.:.|.:.|||..|:..|..||     :.|..:|:.......|...|..
  Fly    90 GRKDWVTTFNTKDIEMVFRNEGIWPRRDGLDSIVYFREHVRPDVYGEVQGLVASQNEAWGKLRSA 154

Mouse   144 LNRNVLSPKAVQKFVPMVDMVARDFLETLKEKVLQNARGSLTMDVQQSLFNYTIEASNFALFGER 208
            :|...:.|:.::.:...:..:..:|:|.:||     .|...|::|.:   ::|.|.|.  |..|.
  Fly   155 INPIFMQPRGLRMYYEPLSNINNEFIERIKE-----IRDPKTLEVPE---DFTDEISR--LVFES 209

Mouse   209 LGLLGHDLSPG----------SLKFIHALHSMFKSTSQLLFLPKSLTRWTSTRVWKEHFDAWDVI 263
            |||:..|...|          :|........:|:.|.:|...|                ..|.:|
  Fly   210 LGLVAFDRQMGLIRKNRDNSDALTLFQTSRDIFRLTFKLDIQP----------------SMWKII 258

Mouse   264 SEYANRCIWKVHQELR--LGSSQTYSGIVAELISQGSLPLDAIKANSM----------------- 309
            |....|   |:.:.|.  |..||.......:.:.:.....:.|.:|||                 
  Fly   259 STPTYR---KMKRTLNDSLNVSQKMLKENQDALEKRRQAGEKINSNSMLERLMEIDPKVAVIMSL 320

Mouse   310 ELTAGSVDTTAIPLVMTLFELARNPDVQKALRQESLA---AEASIAANPQKAMSDLPLLRAALKE 371
            ::....||.||..|...|..|:::||.|..||:|.|:   .:.|:.  .::.|.|:|.|||.:||
  Fly   321 DILFAGVDATATLLSAVLLCLSKHPDKQAKLREELLSIMPTKDSLL--NEENMKDMPYLRAVIKE 383

Mouse   372 TLRLYPVGGFLERILSSDLVLQNYHVPAGTLVLLYLYSMGRNPAVFPRPERYMPQRWLERKRS-- 434
            |||.||.|....|...:|::|..|.||.||.|||....:.:....:|||:.::|:|||....:  
  Fly   384 TLRYYPNGFGTMRTCQNDVILSGYRVPKGTTVLLGSNVLMKEATYYPRPDEFLPERWLRDPETGK 448

Mouse   435 ------FQHLAFGFGVRQCLGRRLAEVEMMLLLHHILKTFQVETLRQEDVQMAYRFVLMPSSSPV 493
                  |..|.||||.|.|:|:|:.::||...:..:::.|.||..|.........|::    .|.
  Fly   449 KMQVSPFTFLPFGFGPRMCIGKRVVDLEMETTVAKLIRNFHVEFNRDASRPFKTMFLM----EPA 509

Mouse   494 LTF 496
            :||
  Fly   510 ITF 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp11b2NP_034121.4 p450 42..496 CDD:365848 118/456 (26%)
Cyp12d1-dNP_995812.1 p450 70..508 CDD:299894 117/452 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8705
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.