DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctsl and CG5367

DIOPT Version :9

Sequence 1:NP_034114.1 Gene:Ctsl / 13039 MGIID:88564 Length:334 Species:Mus musculus
Sequence 2:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster


Alignment Length:344 Identity:122/344 - (35%)
Similarity:199/344 - (57%) Gaps:23/344 - (6%)


- Green bases have known domain annotations that are detailed below.


Mouse     4 LLLLAVLC-LGTALATPKFDQTFS------AEWHQWKSTHRRLYGTNEEEWRR-AIWEKNMRMIQ 60
            |:....|| |...:.|....:..|      :|:.::|:.:.|.|....:|.|. ..:|:|.::|:
  Fly     4 LIFFGCLCGLNCQIVTSNLSEGNSSSANCKSEFEKFKNNNNRKYLRTYDEMRSYKAFEENFKVIE 68

Mouse    61 LHNGEYSNGQHGFSMEMNAFGDMTNEEF-----RQVVNGYRHQKHKKGRLFQEPLMLKIPKSVDW 120
            .||..|..||..|.::.|.|.||:.:.:     |.:.:...........:...|||..:|:|:||
  Fly    69 EHNQNYKEGQTSFRLKPNIFADMSTDGYLKGFLRLLKSNIEDSADNMAEIVGSPLMANVPESLDW 133

Mouse   121 REKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDF 185
            |.||.:||..||..||||:|||.:..:.||:|.:|||::|||:|.:||||.:.|||||.||.:..
  Fly   134 RSKGFITPPYNQLSCGSCYAFSIAESIMGQVFKRTGKILSLSKQQIVDCSVSHGNQGCVGGSLRN 198

Mouse   186 AFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIP-QQEKALMKAVATVGPISVAM 249
            ...|::..||:..::.|||.|:.|.|::..:.:|.|.|.:..:| :.|:|:..||..:||:::::
  Fly   199 TLSYLQSTGGIMRDQDYPYVARKGKCQFVPDLSVVNVTSWAILPVRDEQAIQAAVTHIGPVAISI 263

Mouse   250 DASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGTDSNKNKYWLVKNSWGSEWGMEGYIKI 314
            :||..:.|.||.|||.:|.|||.:::|.::::|:|.:        ||::||.||..||..|||:|
  Fly   264 NASPKTFQLYSDGIYDDPLCSSASVNHAMVVIGFGKD--------YWILKNWWGQNWGENGYIRI 320

Mouse   315 AKDRDNHCGLATAASYPVV 333
            .|. .|.||:|..|:|.:|
  Fly   321 RKG-VNMCGIANYAAYAIV 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtslNP_034114.1 Inhibitor_I29 29..87 CDD:214853 18/58 (31%)
Peptidase_C1 114..331 CDD:365882 91/217 (42%)
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 18/59 (31%)
Peptidase_C1A 128..336 CDD:239068 91/216 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2922
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.780

Return to query results.
Submit another query.