DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctsg and CG18420

DIOPT Version :9

Sequence 1:NP_031826.1 Gene:Ctsg / 13035 MGIID:88563 Length:261 Species:Mus musculus
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:276 Identity:84/276 - (30%)
Similarity:126/276 - (45%) Gaps:53/276 - (19%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MQPLLLLLTFILLQG------DEAG---------KIIGGREARPHSYPYMAFLLIQSPEGLSACG 50
            |..:|||||...|.|      .|.|         :|:.|:.|..:|.|:||||...|.:.:  ||
  Fly     8 MASILLLLTVFPLLGSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLHTSSNQFI--CG 70

Mouse    51 GFLVREDFVLTAAHCL--GSSINVTLGAHNIQM---RERTQQLITVLRAIRHPDYNPQNIRNDIM 110
            |.|:....|||||||.  .::|.|.||.:|.::   ||..|    |.|..:|..|:|....|||.
  Fly    71 GTLISRRLVLTAAHCFIPNTTIVVRLGEYNRKLKGYREEHQ----VNRTFQHRFYDPNTHANDIA 131

Mouse   111 LLQLRRRARRSGSVKPVALP-QASKK--LQPGDLCTVAGWGRVSQSRGTNVLQEVQLRVQMDQMC 172
            ||:|........:::|:.:. .||.|  :....:.|..||||......::.|:.:.:..|..:||
  Fly   132 LLRLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTGTGWGRTESMHDSSELRTLDISRQPSKMC 196

Mouse   173 A------NRFQFYNSQTQICVGNPRERKSAFRGDSGGP---LVCSNVAQGIVSYG----SNNGNP 224
            |      |:|...|..:.:|:           ||:|||   :|....|...|..|    :.....
  Fly   197 AFGSVLSNQFCAGNWNSNLCI-----------GDTGGPVGAMVRYRNAFRFVQVGIAITNKRCQR 250

Mouse   225 PAVFTKIQSFMPWIKR 240
            |:|||.:.|.:.:|:|
  Fly   251 PSVFTDVMSHIEFIRR 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsgNP_031826.1 Tryp_SPc 20..238 CDD:214473 72/238 (30%)
Tryp_SPc 21..241 CDD:238113 74/241 (31%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 72/238 (30%)
Tryp_SPc 43..267 CDD:238113 74/241 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.