DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctsc and CG5367

DIOPT Version :9

Sequence 1:NP_034112.3 Gene:Ctsc / 13032 MGIID:109553 Length:462 Species:Mus musculus
Sequence 2:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster


Alignment Length:370 Identity:105/370 - (28%)
Similarity:164/370 - (44%) Gaps:85/370 - (22%)


- Green bases have known domain annotations that are detailed below.


Mouse   134 WACFVG---KKVESHIEKVNMNAAHLGGLQERYSERLYTHNHNFVKAINTVQKSWTATAYKEYEK 195
            :.|..|   :.|.|::.:.|.::|:.....|::.      |:|..|.:.|..:..:..|::|..|
  Fly     7 FGCLCGLNCQIVTSNLSEGNSSSANCKSEFEKFK------NNNNRKYLRTYDEMRSYKAFEENFK 65

Mouse   196 MSLRDLIRRSGHSQRIPRPKP---APM-TDEIQQQIL------------------------NLPE 232
            : :.:..:.....|...|.||   |.| ||...:..|                        |:||
  Fly    66 V-IEEHNQNYKEGQTSFRLKPNIFADMSTDGYLKGFLRLLKSNIEDSADNMAEIVGSPLMANVPE 129

Mouse   233 SWDWRNVQGVNYVSPVRNQESCGSCYSF----ASMGMLEARI-RILTNNSQTPILSPQEVVSCSP 292
            |.|||:   ..:::|..||.||||||:|    :.||.:..|. :||:       ||.|::|.||.
  Fly   130 SLDWRS---KGFITPPYNQLSCGSCYAFSIAESIMGQVFKRTGKILS-------LSKQQIVDCSV 184

Mouse   293 Y--AQGCDGG-----FPYLIAGKYAQDFGVVEESCFPYTAKDSPCK--PRENCLRYYSSDYYYVG 348
            .  .|||.||     ..||     ....|::.:..:||.|:...|:  |..:.:...|.....|.
  Fly   185 SHGNQGCVGGSLRNTLSYL-----QSTGGIMRDQDYPYVARKGKCQFVPDLSVVNVTSWAILPVR 244

Mouse   349 GFYGGCNEALMKLELVKHGPMAVAFEVH-DDFLHYHSGIYHHTGLSDPFNPFELTNHAVLLVGYG 412
                  :|..::..:...||:|::.... ..|..|..|||     .||.......|||::::|:|
  Fly   245 ------DEQAIQAAVTHIGPVAISINASPKTFQLYSDGIY-----DDPLCSSASVNHAMVVIGFG 298

Mouse   413 RDPVTGIEYWIIKNSWGSNWGESGYFRIRRGTDECAIESIAVAAI 457
            :|      |||:||.||.||||:||.|||:|.:.|.|.:.|..||
  Fly   299 KD------YWILKNWWGQNWGENGYIRIRKGVNMCGIANYAAYAI 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtscNP_034112.3 CathepsinC_exc 26..138 CDD:285926 1/3 (33%)
Pox_I6 168..>204 CDD:252691 7/35 (20%)
Peptidase_C1A_CathepsinC 230..459 CDD:239112 81/243 (33%)
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 16/66 (24%)
Peptidase_C1A 128..336 CDD:239068 79/239 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.