DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctla2a and CG5367

DIOPT Version :9

Sequence 1:NP_031822.2 Gene:Ctla2a / 13024 MGIID:88554 Length:137 Species:Mus musculus
Sequence 2:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster


Alignment Length:109 Identity:31/109 - (28%)
Similarity:54/109 - (49%) Gaps:21/109 - (19%)


- Green bases have known domain annotations that are detailed below.


Mouse    44 KTKFAKAYNLNEERHRRL--------VWEENKKKIEAHNADYEQGKTSFYMGLNQFSDLTPEEF- 99
            |::|.|..|.|..::.|.        .:|||.|.||.||.:|::|:|||.:..|.|:|::.:.: 
  Fly    33 KSEFEKFKNNNNRKYLRTYDEMRSYKAFEENFKVIEEHNQNYKEGQTSFRLKPNIFADMSTDGYL 97

Mouse   100 -------KTNCYGNSLNRGE-----MAPDLPEYEDLGKNSYLTP 131
                   |:|...::.|..|     :..::||..|.....::||
  Fly    98 KGFLRLLKSNIEDSADNMAEIVGSPLMANVPESLDWRSKGFITP 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctla2aNP_031822.2 2 X 3 AA tandem repeats of E-W-K 39..44 31/109 (28%)
Inhibitor_I29 40..98 CDD:214853 22/61 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..137 5/18 (28%)
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 21/59 (36%)
Peptidase_C1A 128..336 CDD:239068 5/14 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.