DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csrp3 and Mlp84B

DIOPT Version :9

Sequence 1:NP_001185770.1 Gene:Csrp3 / 13009 MGIID:1330824 Length:194 Species:Mus musculus
Sequence 2:NP_001303418.1 Gene:Mlp84B / 40849 FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster


Alignment Length:177 Identity:85/177 - (48%)
Similarity:103/177 - (58%) Gaps:3/177 - (1%)


- Green bases have known domain annotations that are detailed below.


Mouse     9 KCGACEKTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTTVAAHESEIYCKVCYGRRYGPKGIGF 73
            ||..|.|:||.|||....|..|||.||.|..|.|:||||....||.|:|||.|:||::||||.||
  Fly    11 KCPRCGKSVYAAEERLAGGYVFHKNCFKCGMCNKSLDSTNCTEHERELYCKTCHGRKFGPKGYGF 75

Mouse    74 GQGAGCLSTDTGEHLGLQFQQSPKPARAATTSNPSKFSAKFGESEKCPRCGKSVYAAEKVMGGGK 138
            |.|||.||.|.|.....:....|.....|...  .:..|:..|.|.|||||..|||||:::..|:
  Fly    76 GTGAGTLSMDNGSQFLRENGDVPSVRNGARLE--PRAIARAPEGEGCPRCGGYVYAAEQMLARGR 138

Mouse   139 PWHKTCFRCAICGKSLESTNVTD-KDGELYCKVCYAKNFGPTGIGFG 184
            .|||.||:|..|.|.|:|....: .|..:|||.||||.|||.|.|:|
  Fly   139 SWHKECFKCGTCKKGLDSILCCEAPDKNIYCKGCYAKKFGPKGYGYG 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Csrp3NP_001185770.1 Interaction with TCAP. /evidence=ECO:0000250|UniProtKB:P50461 1..5
LIM1_CRP3 9..62 CDD:188865 28/52 (54%)
Nuclear localization signal. /evidence=ECO:0000250|UniProtKB:P50463, ECO:0000255 64..69 2/4 (50%)
Interaction with CLF2. /evidence=ECO:0000250|UniProtKB:P50461 94..105 2/10 (20%)
LIM2_CRP3 120..173 CDD:188866 26/53 (49%)
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788 28/52 (54%)
LIM_CRP_like 120..173 CDD:188712 25/52 (48%)
LIM_CRP_like 222..275 CDD:188712
LIM_CRP_like 325..378 CDD:188712
LIM_CRP_like 421..474 CDD:188712
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832343
Domainoid 1 1.000 86 1.000 Domainoid score I8101
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4130
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214165at2759
OrthoFinder 1 1.000 - - FOG0000284
OrthoInspector 1 1.000 - - otm42781
orthoMCL 1 0.900 - - OOG6_104400
Panther 1 1.100 - - LDO PTHR24215
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4662
SonicParanoid 1 1.000 - - X318
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.690

Return to query results.
Submit another query.