DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csrp1 and Mlp84B

DIOPT Version :9

Sequence 1:NP_001347711.1 Gene:Csrp1 / 13007 MGIID:88549 Length:193 Species:Mus musculus
Sequence 2:NP_001303418.1 Gene:Mlp84B / 40849 FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster


Alignment Length:182 Identity:94/182 - (51%)
Similarity:117/182 - (64%) Gaps:2/182 - (1%)


- Green bases have known domain annotations that are detailed below.


Mouse     9 KCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGY 73
            ||..|.|:||.|||....|..|||:||.|.:|.|:||||....|..|:|||:|:|:|:||||||:
  Fly    11 KCPRCGKSVYAAEERLAGGYVFHKNCFKCGMCNKSLDSTNCTEHERELYCKTCHGRKFGPKGYGF 75

Mouse    74 GQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKS 138
            |.||||||.|.|.....::.:.|..|..........|:...| |.||||...|||||:::..|:|
  Fly    76 GTGAGTLSMDNGSQFLRENGDVPSVRNGARLEPRAIARAPEG-EGCPRCGGYVYAAEQMLARGRS 139

Mouse   139 WHKSCFRCAKCGKGLESTTLAD-KDGEIYCKGCYAKNFGPKGFGFGQGAGAL 189
            |||.||:|..|.|||:|....: .|..|||||||||.|||||:|:|||.|||
  Fly   140 WHKECFKCGTCKKGLDSILCCEAPDKNIYCKGCYAKKFGPKGYGYGQGGGAL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Csrp1NP_001347711.1 LIM1_CRP1 8..63 CDD:188863 28/53 (53%)
Nuclear localization signal. /evidence=ECO:0000255 64..69 2/4 (50%)
LIM2_CRP 119..172 CDD:188787 29/53 (55%)
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788 27/52 (52%)
LIM_CRP_like 120..173 CDD:188712 28/52 (54%)
LIM_CRP_like 222..275 CDD:188712
LIM_CRP_like 325..378 CDD:188712
LIM_CRP_like 421..474 CDD:188712
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832341
Domainoid 1 1.000 79 1.000 Domainoid score I8633
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000284
OrthoInspector 1 1.000 - - otm42781
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24215
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4662
SonicParanoid 1 1.000 - - X318
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.