DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBM45 and TIF35

DIOPT Version :9

Sequence 1:XP_016858809.1 Gene:RBM45 / 129831 HGNCID:24468 Length:617 Species:Homo sapiens
Sequence 2:NP_010717.1 Gene:TIF35 / 852039 SGDID:S000002837 Length:274 Species:Saccharomyces cerevisiae


Alignment Length:187 Identity:42/187 - (22%)
Similarity:79/187 - (42%) Gaps:25/187 - (13%)


- Green bases have known domain annotations that are detailed below.


Human   174 APRERTRQPRPPGDRTAVAGLPLSLALTNPPALEFTAKLVLAYFEYFSDLPLSDAQISIYKKRK- 237
            |..||.::.:....:|   ||...|...:...:....|.:|:......|...::..:....:.| 
Yeast    90 AEEERIQKEKASLTKT---GLQCRLCGNDHMTMNCPFKTILSELSALEDPATNEGGVEAASEEKA 151

Human   238 -----NSTFPQVFIAQSR-------SSGSHRD--VEDEELTRIFVMIPKSYTEEDLREKFKV-YG 287
                 ..:.|..::..||       ||.::||  ..|:..|...:.:.::..|..|||:... :.
Yeast   152 GQVGGAGSIPGQYVPPSRRAGARDPSSDAYRDSRERDDMCTLKIMQVNENADENSLREELLFPFA 216

Human   288 DIEYCSIIKNKVTGESKGLGYVRYLKPSQAAQAIENCD-RSFRAIL-----AEPKNK 338
            .|...|:::||.||:|:||.:|.:.....|.||:...| |.:..::     ::||.|
Yeast   217 PIPRVSVVRNKETGKSRGLAFVTFSSEEVAEQALRFLDGRGYMNLILRVEWSKPKVK 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBM45XP_016858809.1 RRM1_RBM45 23..101 CDD:409801
PABP-1234 <41..206 CDD:130689 7/31 (23%)
RRM2_RBM45 263..336 CDD:409802 20/79 (25%)
RRM3_RBM45 389..461 CDD:409803
RRM4_RBM45 534..601 CDD:409804
TIF35NP_010717.1 eIF3g 6..127 CDD:403535 8/39 (21%)
RRM_eIF3G_like 192..268 CDD:409842 20/75 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.