DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COL6A2 and col-58

DIOPT Version :10

Sequence 1:NP_001840.3 Gene:COL6A2 / 1292 HGNCID:2212 Length:1019 Species:Homo sapiens
Sequence 2:NP_491822.2 Gene:col-58 / 184957 WormBaseID:WBGene00000634 Length:289 Species:Caenorhabditis elegans


Alignment Length:209 Identity:92/209 - (44%)
Similarity:104/209 - (49%) Gaps:47/209 - (22%)


- Green bases have known domain annotations that are detailed below.


Human   340 GPPGCKGDPGNRGPDGYPGEAGSPGERGDQGG------KGDPGR-----PGRRGPPGEIGAKGSK 393
            |||   |.||..|.|||.||.|.|   |..||      :.||||     .|..||||.       
 Worm   104 GPP---GPPGFNGEDGYDGEPGVP---GSSGGDDISVLRHDPGRCAQCPAGPMGPPGP------- 155

Human   394 GYQGNSGAPGSPGVKGAKGGPGPRGPKGEPGRRGDPGTKGSPGSDGPKGEKGDPGPEGPRGLAGE 458
                 .|.||.||:.||.      |..|.|||.|.||..|.||..||   .||||.:|.   .|.
 Worm   156 -----RGPPGVPGITGAP------GLDGIPGRHGTPGYPGEPGLPGP---VGDPGFDGK---PGN 203

Human   459 VGNKGAKGDRGLPGPRGPQGALGEPGKQGSRGDPGDAGPRGDSGQPGPKGDPGRPGFSYPGPRGA 523
            .||.|.: .|.:|||.||:||.|:.|.||..|.||.||..||||.|||:|.||:.|..     |.
 Worm   204 PGNNGVR-VRRIPGPPGPRGAEGDSGVQGGPGSPGLAGAPGDSGAPGPQGPPGQKGMD-----GT 262

Human   524 PGEKGEPGPRGPEG 537
            ||..|:|||:|.:|
 Worm   263 PGGFGQPGPQGVDG 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COL6A2NP_001840.3 Nonhelical region 21..256
vWA_collagen_alpha_1-VI-type 43..231 CDD:238757
gly_rich_SclB <255..>513 CDD:468478 82/183 (45%)
Triple-helical region 257..590 92/209 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..588 92/209 (44%)
Cell attachment site. /evidence=ECO:0000255 366..368 0/1 (0%)
Cell attachment site. /evidence=ECO:0000255 426..428 0/1 (0%)
Collagen 487..556 CDD:460189 26/51 (51%)
Cell attachment site. /evidence=ECO:0000255 489..491 0/1 (0%)
Cell attachment site. /evidence=ECO:0000255 498..500 0/1 (0%)
Cell attachment site. /evidence=ECO:0000255 539..541
Nonhelical region 591..1019
vWA_collagen_alpha_1-VI-type 612..803 CDD:238757
VWA 833..1007 CDD:459670
col-58NP_491822.2 Col_cuticle_N 10..61 CDD:198156
gly_rich_SclB <113..>243 CDD:468478 66/157 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.