DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COL6A2 and col-52

DIOPT Version :10

Sequence 1:NP_001840.3 Gene:COL6A2 / 1292 HGNCID:2212 Length:1019 Species:Homo sapiens
Sequence 2:NP_491394.2 Gene:col-52 / 183885 WormBaseID:WBGene00000629 Length:260 Species:Caenorhabditis elegans


Alignment Length:113 Identity:27/113 - (23%)
Similarity:46/113 - (40%) Gaps:24/113 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    11 RDTAMAVEQ-------DIFDAVVMADERFHGEGYQEGYEEGSSLGIVEGKRYGMVHGAKIGSEIG 68
            ||:..|.||       ..|:|:.....:|            .:||: :.|...::.||   ..||
 Worm   170 RDSLTASEQAANTNLPSPFEALENITAKF------------VTLGL-DLKDVVVLSGA---HTIG 218

Human    69 CYRGFALAWKCLLHSGAGEKDRKMKVVEALIALLQD-FPYDDPTYEKL 115
            ..:.|.:..:.....|:|:.|..:....||::.|:| .|..|.:..||
 Worm   219 FAQCFVIKHRLFNFKGSGQPDPNLAASSALLSKLKDTCPNVDSSDSKL 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COL6A2NP_001840.3 Nonhelical region 21..256 22/96 (23%)
vWA_collagen_alpha_1-VI-type 43..231 CDD:238757 19/74 (26%)
gly_rich_SclB <255..>513 CDD:468478
Triple-helical region 257..590
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..588
Cell attachment site. /evidence=ECO:0000255 366..368
Cell attachment site. /evidence=ECO:0000255 426..428
Collagen 487..556 CDD:460189
Cell attachment site. /evidence=ECO:0000255 489..491
Cell attachment site. /evidence=ECO:0000255 498..500
Cell attachment site. /evidence=ECO:0000255 539..541
Nonhelical region 591..1019
vWA_collagen_alpha_1-VI-type 612..803 CDD:238757
VWA 833..1007 CDD:459670
col-52NP_491394.2 gly_rich_SclB <85..>240 CDD:468478 18/85 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.