DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COL6A2 and col-178

DIOPT Version :10

Sequence 1:NP_001840.3 Gene:COL6A2 / 1292 HGNCID:2212 Length:1019 Species:Homo sapiens
Sequence 2:NP_509869.1 Gene:col-178 / 181307 WormBaseID:WBGene00000751 Length:283 Species:Caenorhabditis elegans


Alignment Length:270 Identity:98/270 - (36%)
Similarity:109/270 - (40%) Gaps:80/270 - (29%)


- Green bases have known domain annotations that are detailed below.


Human   256 GPSGPKGYRGQKGAKGNMGEPGEPGQKGRQGDPGIEGPIGFPGPKGVPGFKGEKGEFGADGRKGA 320
            |.:||.|..||:||.||.|:.|:||..|...|.              .||..:..||..|    .
 Worm    93 GETGPAGVPGQEGAPGNDGKAGQPGAPGADADE--------------QGFHYKAPEFCFD----C 139

Human   321 PGLAGKNGTDGQKGKLGRIGPPGCKGDPGNRGPDGYPGEAGSPGERGDQGGKGDPGRPGRRGPPG 385
            |.                 ||||..|.||.:||   ||..|.|||.|..|..|:.|.||.|||||
 Worm   140 PA-----------------GPPGAVGGPGPKGP---PGPPGGPGELGGPGRGGNRGPPGPRGPPG 184

Human   386 EIGAKGSKGYQGNSGAPGSPGVKGAKGGPGPRGPKGEPGRRGDPGTKGSPGSDGPKGEKGDPGPE 450
            |.|..|..|..|.:|.        .:..|.|      ||:.|.||..||||..||.|..|.||..
 Worm   185 EAGPDGEGGRPGQAGQ--------TRSAPSP------PGQPGQPGEPGSPGEPGPDGRAGHPGRN 235

Human   451 GPRGLAGEVGNKGAKGDRGLPGPRGPQGALGEPGKQGSRGDPGDAGPRGDSGQPGPKGDPGRPGF 515
            ||                  |||.|..|..|||||.|..|:.|.|      |..||||....   
 Worm   236 GP------------------PGPPGDNGGQGEPGKDGEDGENGAA------GAAGPKGSCDH--- 273

Human   516 SYPGPRGAPG 525
             .|.||.|||
 Worm   274 -CPPPRTAPG 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COL6A2NP_001840.3 Nonhelical region 21..256 98/270 (36%)
vWA_collagen_alpha_1-VI-type 43..231 CDD:238757
gly_rich_SclB <255..>513 CDD:468478 92/256 (36%)
Triple-helical region 257..590 97/269 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..588 97/269 (36%)
Cell attachment site. /evidence=ECO:0000255 366..368 0/1 (0%)
Cell attachment site. /evidence=ECO:0000255 426..428 0/1 (0%)
Collagen 487..556 CDD:460189 15/39 (38%)
Cell attachment site. /evidence=ECO:0000255 489..491 0/1 (0%)
Cell attachment site. /evidence=ECO:0000255 498..500 0/1 (0%)
Cell attachment site. /evidence=ECO:0000255 539..541
Nonhelical region 591..1019
vWA_collagen_alpha_1-VI-type 612..803 CDD:238757
VWA 833..1007 CDD:459670
col-178NP_509869.1 Col_cuticle_N 15..67 CDD:198156
gly_rich_SclB <93..>269 CDD:468478 90/251 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.