DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COL6A2 and col-162

DIOPT Version :10

Sequence 1:NP_001840.3 Gene:COL6A2 / 1292 HGNCID:2212 Length:1019 Species:Homo sapiens
Sequence 2:NP_506334.1 Gene:col-162 / 179825 WormBaseID:WBGene00000735 Length:291 Species:Caenorhabditis elegans


Alignment Length:192 Identity:87/192 - (45%)
Similarity:99/192 - (51%) Gaps:21/192 - (10%)


- Green bases have known domain annotations that are detailed below.


Human   340 GPPGCKGDPGNRGPDGYPGEAGSPGERGDQGGKGDPGRPGRRGPPGEIGAKGSKGYQGNSGAPGS 404
            ||||..|.||..|.||:.||||.||..|...|....|.|..:.|.||.|..|..|..|.:|..|.
 Worm    91 GPPGPPGAPGAPGDDGHAGEAGKPGTAGVAVGIVSEGGPCIKCPAGEPGPAGEAGAPGPAGPDGQ 155

Human   405 PGVKGAKGGPGPRGPKGEPGRRGDPGTKGSPGSDGPKGEKGDPGPEGPRGLAGEVGNKGAKGDRG 469
            ||..|..|.|||.||.|.   .||.|..|:||.|   |:.|.||.:|.|       :.|..|..|
 Worm   156 PGQDGQGGQPGPAGPAGP---AGDAGAPGAPGQD---GQPGAPGQDGHR-------STGTPGAAG 207

Human   470 LPGPRGPQGALGEPGKQGSRGDPGDAGPRGDSGQPGPKGDPGRPGFSYPGPRGAPGEKGEPG 531
            .|||.||.|..|:|   ||.|.||:||.   .|.|||.|.||:||  ..|..||||:.|:||
 Worm   208 APGPAGPAGQDGQP---GSAGGPGEAGA---PGAPGPDGQPGQPG--QDGEAGAPGQDGQPG 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COL6A2NP_001840.3 Nonhelical region 21..256
vWA_collagen_alpha_1-VI-type 43..231 CDD:238757
gly_rich_SclB <255..>513 CDD:468478 77/172 (45%)
Triple-helical region 257..590 87/192 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..588 87/192 (45%)
Cell attachment site. /evidence=ECO:0000255 366..368 0/1 (0%)
Cell attachment site. /evidence=ECO:0000255 426..428 0/1 (0%)
Collagen 487..556 CDD:460189 24/45 (53%)
Cell attachment site. /evidence=ECO:0000255 489..491 0/1 (0%)
Cell attachment site. /evidence=ECO:0000255 498..500 0/1 (0%)
Cell attachment site. /evidence=ECO:0000255 539..541
Nonhelical region 591..1019
vWA_collagen_alpha_1-VI-type 612..803 CDD:238757
VWA 833..1007 CDD:459670
col-162NP_506334.1 Col_cuticle_N 5..57 CDD:198156
gly_rich_SclB <108..>263 CDD:468478 77/175 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.