DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COL6A2 and dpy-4

DIOPT Version :10

Sequence 1:NP_001840.3 Gene:COL6A2 / 1292 HGNCID:2212 Length:1019 Species:Homo sapiens
Sequence 2:NP_502808.1 Gene:dpy-4 / 178414 WormBaseID:WBGene00001066 Length:289 Species:Caenorhabditis elegans


Alignment Length:274 Identity:99/274 - (36%)
Similarity:117/274 - (42%) Gaps:83/274 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   344 CKGD--PGNRGPDGYPGEAGSPGERGDQGGKGDPGRPGRRGPPGEIGAKGSKGYQGNSGAPGSPG 406
            |.|.  ||.:||.|.||:.|.||:.|..|..|.||||.::  |.|               |.:| 
 Worm    86 CAGCCLPGPQGPQGTPGKPGKPGKPGAPGQPGTPGRPPQQ--PCE---------------PTTP- 132

Human   407 VKGAKGGPGPRGPKGEPGRRGDPGTKGSPGSDGPKGEKGDPGPEGPRGLAGEVGNKGAKGDRGLP 471
               ....|.|:||.|.||:.|.||..|.||..||||....||.                     |
 Worm   133 ---PPCQPCPQGPPGPPGQPGIPGDNGPPGEQGPKGPDAAPGE---------------------P 173

Human   472 GPRGPQGALGEPGKQGSRGDPGDAGPRGDSGQPGPKGDPGRPGFSYPGPRGAPGEKGEPGPRGPE 536
            ||:||   :|.|            ||.|.:|.||..|.|.:...:.|||.|.||:.|:.||.||.
 Worm   174 GPKGP---IGPP------------GPPGQAGAPGEPGSPAKSEPAVPGPPGPPGQAGQQGPPGPP 223

Human   537 GGRGDFGLKGEPGRKGEKGEPADPGPPGEPGPRGPRGVPGPEGEPGPPGDPGLTECDVMTYVRET 601
            |..|..|..|.||.|||      ||.|||||..|..|.||..|:.|.||:.|:            
 Worm   224 GSNGIDGAPGAPGAKGE------PGTPGEPGKDGEPGKPGTPGQDGTPGEKGI------------ 270

Human   602 CGCCDCEKRCGALD 615
                 |.|.| |||
 Worm   271 -----CPKYC-ALD 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COL6A2NP_001840.3 Nonhelical region 21..256
vWA_collagen_alpha_1-VI-type 43..231 CDD:238757
gly_rich_SclB <255..>513 CDD:468478 57/170 (34%)
Triple-helical region 257..590 93/247 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..588 92/245 (38%)
Cell attachment site. /evidence=ECO:0000255 366..368 0/1 (0%)
Cell attachment site. /evidence=ECO:0000255 426..428 0/1 (0%)
Collagen 487..556 CDD:460189 28/68 (41%)
Cell attachment site. /evidence=ECO:0000255 489..491 0/1 (0%)
Cell attachment site. /evidence=ECO:0000255 498..500 0/1 (0%)
Cell attachment site. /evidence=ECO:0000255 539..541 0/1 (0%)
Nonhelical region 591..1019 6/25 (24%)
vWA_collagen_alpha_1-VI-type 612..803 CDD:238757 3/4 (75%)
VWA 833..1007 CDD:459670
dpy-4NP_502808.1 Col_cuticle_N 12..64 CDD:198156
gly_rich_SclB <93..>269 CDD:468478 89/238 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.