DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COL6A2 and col-119

DIOPT Version :10

Sequence 1:NP_001840.3 Gene:COL6A2 / 1292 HGNCID:2212 Length:1019 Species:Homo sapiens
Sequence 2:NP_501561.1 Gene:col-119 / 177715 WormBaseID:WBGene00000693 Length:289 Species:Caenorhabditis elegans


Alignment Length:288 Identity:104/288 - (36%)
Similarity:121/288 - (42%) Gaps:82/288 - (28%)


- Green bases have known domain annotations that are detailed below.


Human   338 RIGPPGCKGD--PGNRGPDGYPGEAGSPGERGDQGGKGDPGRPGRRGPPGEIGAKGSKGYQGNSG 400
            ::|...|:|.  ||.:||.|.||.||.||:.|..|..|:||||.:.  |.|              
 Worm    80 QVGNGQCEGCCLPGAQGPPGTPGRAGRPGKPGAPGLNGNPGRPPKE--PCE-------------- 128

Human   401 APGSPGVKGAKGGPGPRGPKGEPGRRGDPGTKGSPGSDGPKGEKGDPGPEGPRGLAGEVGNKGAK 465
             |.:|             |..:|...|.||..|.||..|.||..|.|||.||.|..|..||||..
 Worm   129 -PITP-------------PPCKPCPEGPPGPAGPPGPQGNKGPLGPPGPPGPEGPNGTAGNKGPA 179

Human   466 GDRGLPGPRGPQGALGEPGKQGSRGDPGDAGPRGDSGQPGPKGDPGRPGFSYPGPRGAPGEKGEP 530
            |.   |||.|..|..|.||:.|..|:|          |||..|:||||              |:|
 Worm   180 GP---PGPGGKPGPAGPPGENGRNGEP----------QPGSPGEPGRP--------------GQP 217

Human   531 GPRGPEGGRGDFGLKGEPGRKGEKGEPADPGPPGEPGPRGPRGVPGPEGEPGPPGDPGLTECDVM 595
            |.|||.|..|..|.:|.||.||..|||..||..|:||.      ||..|..|.||:.|:      
 Worm   218 GSRGPAGQPGKDGAQGGPGEKGANGEPGQPGRDGQPGR------PGQPGRDGHPGEKGV------ 270

Human   596 TYVRETCGCCDCEKRCGALDVVFVIDSS 623
                       |.|.|.....||..|.|
 Worm   271 -----------CPKYCALDGGVFFEDGS 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COL6A2NP_001840.3 Nonhelical region 21..256
vWA_collagen_alpha_1-VI-type 43..231 CDD:238757
gly_rich_SclB <255..>513 CDD:468478 66/176 (38%)
Triple-helical region 257..590 97/253 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..588 96/251 (38%)
Cell attachment site. /evidence=ECO:0000255 366..368 0/1 (0%)
Cell attachment site. /evidence=ECO:0000255 426..428 0/1 (0%)
Collagen 487..556 CDD:460189 25/68 (37%)
Cell attachment site. /evidence=ECO:0000255 489..491 0/1 (0%)
Cell attachment site. /evidence=ECO:0000255 498..500 0/1 (0%)
Cell attachment site. /evidence=ECO:0000255 539..541 0/1 (0%)
Nonhelical region 591..1019 7/33 (21%)
vWA_collagen_alpha_1-VI-type 612..803 CDD:238757 4/12 (33%)
VWA 833..1007 CDD:459670
col-119NP_501561.1 Col_cuticle_N 12..64 CDD:198156
gly_rich_SclB <92..>269 CDD:468478 93/239 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.