DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COL6A2 and col-33

DIOPT Version :10

Sequence 1:NP_001840.3 Gene:COL6A2 / 1292 HGNCID:2212 Length:1019 Species:Homo sapiens
Sequence 2:NP_500524.2 Gene:col-33 / 177191 WormBaseID:WBGene00000610 Length:304 Species:Caenorhabditis elegans


Alignment Length:287 Identity:101/287 - (35%)
Similarity:113/287 - (39%) Gaps:103/287 - (35%)


- Green bases have known domain annotations that are detailed below.


Human   244 GECYKVSCLEIPGPSGPKGYRGQKGAKGNMGEPGEPGQKGRQGDPGIEGPIGFPGPKGVPGFKGE 308
            |.| :..||  |||:||      .||.||.|.||:||..|..|:|| :.|:....|         
 Worm    99 GNC-EACCL--PGPAGP------AGAPGNPGRPGKPGAPGLPGNPG-KPPVQPCEP--------- 144

Human   309 KGEFGADGRKGAPGLAGKNGTDGQKGKLGRIGPPGCKGDPGNRGPDGYPGEAGSPGERGDQGGKG 373
                                          |.||.||..|.  ||.|.||..|:|   ||.|..|
 Worm   145 ------------------------------ITPPPCKPCPD--GPAGPPGPPGAP---GDAGTNG 174

Human   374 DPGRPGRRGPPGEIGAKGSKGYQGNSGAPGSPGVKGAKGGPGPRGPKGEPGRRGDPGTKGSPGSD 438
            .||.||...||||                           .||:||.|.||..|.||..|.||.|
 Worm   175 APGAPGGDAPPGE---------------------------AGPKGPPGPPGSPGAPGEPGRPGDD 212

Human   439 GPKGE--KGDPGPEGPRGLAGEVGNKGAKGDRGLPGPRGPQGALGEPGKQGSRGDPGDAGPRGDS 501
            .|...  .|:|||:||                  |||.|..|..|:||..|..|.||..||.|:.
 Worm   213 APSEPLIPGEPGPQGP------------------PGPPGQAGPDGQPGAPGGPGTPGSKGPPGNP 259

Human   502 GQPGPKGDPGRPGFSYPGPRGAPGEKG 528
            |.||..|.||.||  ..||.||.||||
 Worm   260 GAPGADGKPGAPG--QAGPAGAKGEKG 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COL6A2NP_001840.3 Nonhelical region 21..256 4/11 (36%)
vWA_collagen_alpha_1-VI-type 43..231 CDD:238757
gly_rich_SclB <255..>513 CDD:468478 87/259 (34%)
Triple-helical region 257..590 95/274 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..588 95/274 (35%)
Cell attachment site. /evidence=ECO:0000255 366..368 0/1 (0%)
Cell attachment site. /evidence=ECO:0000255 426..428 0/1 (0%)
Collagen 487..556 CDD:460189 23/42 (55%)
Cell attachment site. /evidence=ECO:0000255 489..491 0/1 (0%)
Cell attachment site. /evidence=ECO:0000255 498..500 0/1 (0%)
Cell attachment site. /evidence=ECO:0000255 539..541
Nonhelical region 591..1019
vWA_collagen_alpha_1-VI-type 612..803 CDD:238757
VWA 833..1007 CDD:459670
col-33NP_500524.2 Col_cuticle_N 15..67 CDD:198156
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.