DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COL6A2 and col-107

DIOPT Version :10

Sequence 1:NP_001840.3 Gene:COL6A2 / 1292 HGNCID:2212 Length:1019 Species:Homo sapiens
Sequence 2:NP_872105.1 Gene:col-107 / 176961 WormBaseID:WBGene00000681 Length:294 Species:Caenorhabditis elegans


Alignment Length:343 Identity:111/343 - (32%)
Similarity:137/343 - (39%) Gaps:95/343 - (27%)


- Green bases have known domain annotations that are detailed below.


Human   201 LRDIASTPHELYRND-YATMLPDSTEIDQDTINRIIKVMKHEAYGECYKVSCLEIPGPSGPKG-- 262
            |:||         || |..::.|.||. ::|.|            |.:|    ::..|||...  
 Worm    29 LQDI---------NDLYYDVMDDMTEF-RNTAN------------EAWK----DMIVPSGAVDAS 67

Human   263 --YRGQKGAKGNMGEPGEPGQKGRQGDPGIEGPIGFPGPKGVPGFKGEKGEFGADGRKGAPGLAG 325
              :...|.:.|..|...:|.          ..|.|..||.|.|         ||.|..|.||.||
 Worm    68 LIFGRNKRSGGTCGCGAQPN----------NCPAGPAGPPGAP---------GAPGEDGTPGQAG 113

Human   326 KNGTDGQKGKLGRIGPPGC----KGDPGNRGPDGYPGEAGSPGERGDQGGKGDPGRPGRRGPPGE 386
            |||.:| .|.:......||    .|:||..|||   |.||:|      |..|.||.||.   .|:
 Worm   114 KNGGNG-IGIVNSADAGGCIKCPAGEPGPAGPD---GPAGAP------GADGQPGAPGN---AGQ 165

Human   387 IGAKGSKGYQGNSGAPGSPGVKGAKGGPGPRGPKGEPGRRGDPGTKGSPGSDGPKGEKGDPGPEG 451
            .||.|:.|.||::||.|..|..||.||||..|.:|                      .|.|||.|
 Worm   166 DGAPGAAGEQGDAGAAGQDGEAGAPGGPGKNGQRG----------------------SGAPGPAG 208

Human   452 PRGLAGEVGNKGAKGDRGLPGPRGPQGALGEPGKQGSRGDPGDAGPRGDSGQPGPKGDPGRPGFS 516
            |.|.||..|..||.|..|.||..|.:|..|.|||.|..|.|      |..|:.|.:|.||:....
 Worm   209 PEGPAGPAGQDGAPGQDGAPGNAGSEGPAGAPGKDGEAGAP------GQDGEAGGEGIPGQDAAY 267

Human   517 YPGPRGAPGEKGEPGPRG 534
            .|.|......:..|..:|
 Worm   268 CPCPPRTAAVEATPASQG 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COL6A2NP_001840.3 Nonhelical region 21..256 13/55 (24%)
vWA_collagen_alpha_1-VI-type 43..231 CDD:238757 9/30 (30%)
gly_rich_SclB <255..>513 CDD:468478 94/265 (35%)
Triple-helical region 257..590 98/286 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..588 98/286 (34%)
Cell attachment site. /evidence=ECO:0000255 366..368 0/1 (0%)
Cell attachment site. /evidence=ECO:0000255 426..428 0/1 (0%)
Collagen 487..556 CDD:460189 13/48 (27%)
Cell attachment site. /evidence=ECO:0000255 489..491 0/1 (0%)
Cell attachment site. /evidence=ECO:0000255 498..500 0/1 (0%)
Cell attachment site. /evidence=ECO:0000255 539..541
Nonhelical region 591..1019
vWA_collagen_alpha_1-VI-type 612..803 CDD:238757
VWA 833..1007 CDD:459670
col-107NP_872105.1 Col_cuticle_N 6..57 CDD:198156 13/53 (25%)
gly_rich_SclB <105..>264 CDD:468478 78/199 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.