DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COL6A2 and col-97

DIOPT Version :10

Sequence 1:NP_001840.3 Gene:COL6A2 / 1292 HGNCID:2212 Length:1019 Species:Homo sapiens
Sequence 2:NP_499700.1 Gene:col-97 / 176721 WormBaseID:WBGene00000672 Length:298 Species:Caenorhabditis elegans


Alignment Length:246 Identity:93/246 - (37%)
Similarity:109/246 - (44%) Gaps:65/246 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   375 PGRPGRRGPPGEIGAKGSKGYQGNSGAPGSPGVKGAKGGPGPRGPK-----GEPGRRGDPGTKGS 434
            ||.||..||||:            :||||.||..||.|.|| |.|.     .||           
 Worm   102 PGLPGPDGPPGK------------NGAPGRPGAPGAPGFPG-RPPAVCEEITEP----------- 142

Human   435 PGSDGPKGEKGDPGPEGPRGLAGEVGNKGAKGDRGLPGPRGPQGALGEPGKQGSRGDPGDAGPRG 499
            |.:..|.||.|.|||.|..|..|:.|:.|..|:.|..||:||               ||..|..|
 Worm   143 PCTPCPPGEPGPPGPPGDAGNPGQSGHPGRNGNDGGVGPQGP---------------PGPPGNNG 192

Human   500 DSGQPGPKGDPGRPGFSYPGPRGAPGEKGEPGPRGPEGGRGDFGLKGEPGRKGEKGEPADPGPPG 564
            :.|:.||:|:.|||..|.|...|.||..|||||.|..|.:|..|..|..|..|.:|.|..||..|
 Worm   193 EGGRDGPRGEQGRPAISTPALPGDPGAPGEPGPSGLPGDQGQAGRPGSDGAPGPQGPPGPPGQQG 257

Human   565 EPGPRGPRGVPGPEGEPGPPGDPGLTECDVMTYVRETCGCCDCEKRCGALD 615
            .||..||.|.|   |:|||.|:.|:                 |.|.| |||
 Worm   258 HPGQAGPAGQP---GQPGPQGERGI-----------------CPKYC-ALD 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COL6A2NP_001840.3 Nonhelical region 21..256
vWA_collagen_alpha_1-VI-type 43..231 CDD:238757
gly_rich_SclB <255..>513 CDD:468478 51/142 (36%)
Triple-helical region 257..590 87/219 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..588 86/217 (40%)
Cell attachment site. /evidence=ECO:0000255 366..368
Cell attachment site. /evidence=ECO:0000255 426..428 0/1 (0%)
Collagen 487..556 CDD:460189 28/68 (41%)
Cell attachment site. /evidence=ECO:0000255 489..491 0/1 (0%)
Cell attachment site. /evidence=ECO:0000255 498..500 0/1 (0%)
Cell attachment site. /evidence=ECO:0000255 539..541 0/1 (0%)
Nonhelical region 591..1019 6/25 (24%)
vWA_collagen_alpha_1-VI-type 612..803 CDD:238757 3/4 (75%)
VWA 833..1007 CDD:459670
col-97NP_499700.1 Col_cuticle_N 12..64 CDD:198156
gly_rich_SclB <118..>241 CDD:468478 57/149 (38%)
Collagen 198..>240 CDD:460189 20/41 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.