DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COL6A2 and col-8

DIOPT Version :10

Sequence 1:NP_001840.3 Gene:COL6A2 / 1292 HGNCID:2212 Length:1019 Species:Homo sapiens
Sequence 2:NP_001370389.1 Gene:col-8 / 175981 WormBaseID:WBGene00000597 Length:294 Species:Caenorhabditis elegans


Alignment Length:328 Identity:120/328 - (36%)
Similarity:142/328 - (43%) Gaps:93/328 - (28%)


- Green bases have known domain annotations that are detailed below.


Human   213 RNDYATMLPDSTEIDQDTINRIIKVMKHEAYGECYKVSCLEIPG-------PSGPKGYRGQKGAK 270
            ::|:...:.:...|.:||..||  |.||            ..||       .|.|..:....|.:
 Worm    35 QSDFDDEMFEFRAITKDTWQRI--VTKH------------TYPGGVDEETIESHPPTFETLFGTR 85

Human   271 GNMGEPGEPGQKGRQG-------DPGIEG-PIGFPGPKGVPGFKGEKGEFGADGRKGAPGLAGKN 327
                       |.||.       .|..|| |.|.|||.|..|..||.|..|.||:.||||:....
 Worm    86 -----------KARQAYPEQCNCGPKSEGCPAGPPGPPGEGGQSGEPGHDGDDGKPGAPGVIVAI 139

Human   328 GTDGQKGKLGRIGPPGC----KGDPGNRGPDGYPGEAGSPGERGDQGGKGDPGRPGRRGPPGEIG 388
            ..|         .|.||    .|.||.|||.|..|.||..|::            ||.||||..|
 Worm   140 THD---------IPGGCIKCPPGRPGPRGPSGLVGPAGPAGDQ------------GRHGPPGPTG 183

Human   389 AKGSKGYQGNSGAPGSPGVKGAKGGPGPRGPKGEPGRRGDPGTKGSPGSDGPKGEKGDPGPEGPR 453
            .:|..|.||::|.|      ||.|.|||.||:||||....|   |..|..||.|.:|.|||||..
 Worm   184 GQGGPGEQGDAGRP------GAAGRPGPPGPRGEPGTEYRP---GQAGRAGPPGPRGPPGPEGNP 239

Human   454 GLAGEVGNKGAKGDRGLPG-PRGPQGALGEPGKQGSRGDPGDAGPRGDSGQPGPKGDPGR---PG 514
            |.|||.||:|..|..|:|| |       |.|||.|:.|:.|  ||    |:|||  |.|.   ||
 Worm   240 GGAGEDGNQGPVGHPGVPGRP-------GIPGKSGTCGEHG--GP----GEPGP--DAGYCPCPG 289

Human   515 FSY 517
            .||
 Worm   290 RSY 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COL6A2NP_001840.3 Nonhelical region 21..256 9/42 (21%)
vWA_collagen_alpha_1-VI-type 43..231 CDD:238757 3/17 (18%)
gly_rich_SclB <255..>513 CDD:468478 107/280 (38%)
Triple-helical region 257..590 109/277 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..588 109/277 (39%)
Cell attachment site. /evidence=ECO:0000255 366..368 0/1 (0%)
Cell attachment site. /evidence=ECO:0000255 426..428 0/1 (0%)
Collagen 487..556 CDD:460189 15/34 (44%)
Cell attachment site. /evidence=ECO:0000255 489..491 0/1 (0%)
Cell attachment site. /evidence=ECO:0000255 498..500 0/1 (0%)
Cell attachment site. /evidence=ECO:0000255 539..541
Nonhelical region 591..1019
vWA_collagen_alpha_1-VI-type 612..803 CDD:238757
VWA 833..1007 CDD:459670
col-8NP_001370389.1 Col_cuticle_N 4..56 CDD:198156 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.