DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COL6A2 and col-79

DIOPT Version :10

Sequence 1:NP_001840.3 Gene:COL6A2 / 1292 HGNCID:2212 Length:1019 Species:Homo sapiens
Sequence 2:NP_496308.1 Gene:col-79 / 174650 WormBaseID:WBGene00000655 Length:283 Species:Caenorhabditis elegans


Alignment Length:247 Identity:98/247 - (39%)
Similarity:112/247 - (45%) Gaps:58/247 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   276 PGEP----GQKGRQGDP--GIEGPIGFPGPKGVPGFKGEKGEFGADGRKGAPGLAGKNG------ 328
            |..|    |:..|.||.  ..|.|...||  |.||..||||..|.||..|.||..|:||      
 Worm    65 PPSPSLIFGRNKRSGDKCNCSEEPSNCPG--GPPGPPGEKGNDGVDGVDGIPGFPGENGGAALDQ 127

Human   329 -TDGQKGKLGRIGPPGC-KGDPGNRGPDGYPGEAGSPGERGDQGGKGDPGRPGRRGPPGEIGAKG 391
             .||.           | |..||.|||                     ||..|..||.|::|..|
 Worm   128 PADGT-----------CIKCPPGPRGP---------------------PGPQGEEGPSGDVGEDG 160

Human   392 SKGYQGNSGAPGSPGVKGAKGGPGPRGPKGEPGRRGDPGTKGSPGSDGPKGEKGDPGPEGPRGLA 456
            ..|..||.||.|:||..||.||.||:||.|.|||.|.||.| :.|..||||..|.||.:|.|   
 Worm   161 EPGVPGNDGADGTPGKSGAPGGKGPQGPPGTPGRPGQPGRK-AIGEAGPKGPPGAPGTDGRR--- 221

Human   457 GEVGNKGAKGDRGLPGPRGPQGALGEPGKQGSRGDPGDAGPRGDSGQPGPKG 508
               |..|..||.|:.|..|.:   |:.||.|:.|:||..|.:|..||||..|
 Worm   222 ---GENGTDGDDGVDGQPGDE---GDAGKDGTPGEPGPQGEQGTEGQPGTDG 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COL6A2NP_001840.3 Nonhelical region 21..256
vWA_collagen_alpha_1-VI-type 43..231 CDD:238757
gly_rich_SclB <255..>513 CDD:468478 98/247 (40%)
Triple-helical region 257..590 98/247 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..588 98/247 (40%)
Cell attachment site. /evidence=ECO:0000255 366..368 0/1 (0%)
Cell attachment site. /evidence=ECO:0000255 426..428 0/1 (0%)
Collagen 487..556 CDD:460189 11/22 (50%)
Cell attachment site. /evidence=ECO:0000255 489..491 0/1 (0%)
Cell attachment site. /evidence=ECO:0000255 498..500 0/1 (0%)
Cell attachment site. /evidence=ECO:0000255 539..541
Nonhelical region 591..1019
vWA_collagen_alpha_1-VI-type 612..803 CDD:238757
VWA 833..1007 CDD:459670
col-79NP_496308.1 Col_cuticle_N 5..57 CDD:198156
gly_rich_SclB <101..>267 CDD:468478 83/207 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.