DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COL6A2 and col-53

DIOPT Version :10

Sequence 1:NP_001840.3 Gene:COL6A2 / 1292 HGNCID:2212 Length:1019 Species:Homo sapiens
Sequence 2:NP_491651.3 Gene:col-53 / 172222 WormBaseID:WBGene00000630 Length:278 Species:Caenorhabditis elegans


Alignment Length:206 Identity:92/206 - (44%)
Similarity:103/206 - (50%) Gaps:38/206 - (18%)


- Green bases have known domain annotations that are detailed below.


Human   339 IGPPGCKGDPGNRGPDGY---PGEAGSPGERGDQGGK---------GDPGRPGRRGPPGEIGAKG 391
            |||||.||.||....|||   ||..|.||...|...:         |.|||.|..||.|..|.:|
 Worm    82 IGPPGMKGFPGKNSRDGYDGEPGRDGQPGRPADGDSRMVCIRECPTGRPGREGGDGPKGSKGQRG 146

Human   392 SKGYQGNSGAP---GSPGVKGAKGGPGPRGPKGEPGRRGDPGTKGSPG----SDGPKGEKGDPGP 449
            ..|.||:|..|   |.||.:|.||.||..||.|||         |.||    ||||.|:.|:.||
 Worm   147 RTGQQGDSAPPSIRGEPGERGDKGFPGVAGPAGEP---------GEPGHIYVSDGPPGKDGETGP 202

Human   450 EGPRGLAGEVGNKGAKGDRGLPGPRGPQGALGEPGKQGSRGDPGDAGPRGDSGQPGPKGDPGRPG 514
            .||   .||.|..|..|:.||||.|      ||.|.||.:|:.|..||.|..|..||||:|. |.
 Worm   203 RGP---PGEKGRTGRDGEDGLPGER------GERGYQGLKGEIGKRGPVGTFGPIGPKGEPW-PC 257

Human   515 FSYPGPRGAPG 525
            .|.|.||.:||
 Worm   258 ESCPPPRVSPG 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COL6A2NP_001840.3 Nonhelical region 21..256
vWA_collagen_alpha_1-VI-type 43..231 CDD:238757
gly_rich_SclB <255..>513 CDD:468478 85/192 (44%)
Triple-helical region 257..590 92/206 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..588 92/206 (45%)
Cell attachment site. /evidence=ECO:0000255 366..368 0/1 (0%)
Cell attachment site. /evidence=ECO:0000255 426..428 0/1 (0%)
Collagen 487..556 CDD:460189 19/39 (49%)
Cell attachment site. /evidence=ECO:0000255 489..491 0/1 (0%)
Cell attachment site. /evidence=ECO:0000255 498..500 0/1 (0%)
Cell attachment site. /evidence=ECO:0000255 539..541
Nonhelical region 591..1019
vWA_collagen_alpha_1-VI-type 612..803 CDD:238757
VWA 833..1007 CDD:459670
col-53NP_491651.3 gly_rich_SclB <83..>251 CDD:468478 80/185 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.