DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Creb3 and CrebA

DIOPT Version :9

Sequence 1:NP_038525.2 Gene:Creb3 / 12913 MGIID:99946 Length:379 Species:Mus musculus
Sequence 2:NP_524087.3 Gene:CrebA / 39682 FlyBaseID:FBgn0004396 Length:516 Species:Drosophila melanogaster


Alignment Length:217 Identity:79/217 - (36%)
Similarity:115/217 - (52%) Gaps:33/217 - (15%)


- Green bases have known domain annotations that are detailed below.


Mouse    13 PGDQDLLGFLLEESGDLWAATEPDVKAPLDLELSPS--ENSVQELSDWEVEDLLSSLLSPSVSRD 75
            |.| |..|.|..|  .|:|...|:....:.: .:|:  |:||:           .|..:.|::|.
  Fly   323 PSD-DSEGNLSPE--HLFAPLSPNATVSISV-ANPAGGESSVR-----------VSRTAASITRS 372

Mouse    76 VLGSSSSSILHDHNYSLPQEHVSIDLDTESFEKEGFHVTPLPGEERAAEQEMSRLILTEEEKKLL 140
            ..||:|:|             .|....|.:..::..| |||...:  .:.....|:||||||:.|
  Fly   373 SSGSASAS-------------GSSTSSTVTTTRQPIH-TPLISSQ--PKGSTGTLLLTEEEKRTL 421

Mouse   141 EKEGLTLPSTLPLTKVEEQVLKRVRRKIRNKRAAQESRKKKKVYVVGLESRVLKYTAQNRELQNK 205
            ..||..:|..|||||.||:.||::||||:||.:|||||:|||.|:..||.||.....:|.:.:.:
  Fly   422 LAEGYPIPQKLPLTKAEEKSLKKIRRKIKNKISAQESRRKKKEYMDQLERRVEILVTENHDYKKR 486

Mouse   206 VQRLEEQNLSLLDQLRKLQAMV 227
            ::.|||.|.:||.||.||||:|
  Fly   487 LEGLEETNANLLSQLHKLQALV 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Creb3NP_038525.2 bZIP_CREB3 161..221 CDD:269837 29/59 (49%)
coiled coil 163..214 CDD:269837 23/50 (46%)
CrebANP_524087.3 bZIP_CREB3 452..502 CDD:269837 22/49 (45%)
coiled coil 452..495 CDD:269837 18/42 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834552
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0709
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D288251at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.