DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Creb1 and kay

DIOPT Version :9

Sequence 1:NP_034082.1 Gene:Creb1 / 12912 MGIID:88494 Length:341 Species:Mus musculus
Sequence 2:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster


Alignment Length:435 Identity:84/435 - (19%)
Similarity:145/435 - (33%) Gaps:125/435 - (28%)


- Green bases have known domain annotations that are detailed below.


Mouse    10 QQSGDAAVTEAENQQMTVQAQP-----------------------QIATLAQVSMPAAHATSSAP 51
            ||...|...:..:||..:..||                       .:|:.|..:...:|.:::|.
  Fly    46 QQQQQAPQQQLRHQQRQLPTQPAYQQSQSVAHNAFPLRSSSNNYGHVASSAYAASSGSHNSNNAA 110

Mouse    52 TVTLV---------------QLP-NGQTVQVHGVIQAAQ---PSVIQSP----------QVQ--- 84
            .:..|               ||. |...:.::...|..|   ||..||.          |.|   
  Fly   111 AMAAVCQMQNFFNQQQQQQQQLEFNNNCMPINYYQQQQQQHYPSESQSSASGWNPETPGQAQLAL 175

Mouse    85 -------TVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLS 142
                   |..::|.......:.|..::.|...|:..|.:...|:.:....|:         |:|.
  Fly   176 TATTCNTTAAATCNTTAAATTSTTATSAAAGSDNNHSDNFAMDASEIATFLA---------NELF 231

Mouse   143 SDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQ--------GGAI-QLANNGT 198
            ....|  ..|..:|....:.|.:|..|  |...:.:.|..::.||        |.|: ::..|..
  Fly   232 LQQLG--NFETGQSVLTLTTPTLTPTT--TRNIEDTLGHLLSDTQTDRVAGCAGFAVPKVLPNAI 292

Mouse   199 D--------GVQGL---QTLTMT--------NAAATQPGTTILQYAQTTDGQQILVPSNQVV--- 241
            |        ||..|   ||..::        ::.|:...|.:.:...|||.......|....   
  Fly   293 DVLGMGIPTGVSSLPLQQTFDLSLGQGSESEDSNASYNDTQMNEEQDTTDTSSAHTDSTSYQAGH 357

Mouse   242 VQAAS---GDVQTYQIRTAPTSTIAPGVVMASS----------------PALPTQPAEEAARKRE 287
            :.|.|   |.|..:....|..|:......:.||                |...|....|..:||.
  Fly   358 IMAGSVNGGGVNNFSNVLAAVSSSRGSASVGSSNANTSNTPARRGGGRRPNRSTNMTPEEEQKRA 422

Mouse   288 VRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKAL 332
            ||..:|::||..||:::.:....|...|..||.:.:::.:|::.|
  Fly   423 VRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVL 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Creb1NP_034082.1 pKID 113..151 CDD:366954 6/37 (16%)
bZIP_CREB1 285..339 CDD:269838 15/48 (31%)
coiled coil 286..338 CDD:269838 14/47 (30%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 15/48 (31%)
coiled coil 421..480 CDD:269869 14/47 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.