DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpa3 and CG8562

DIOPT Version :9

Sequence 1:NP_031779.1 Gene:Cpa3 / 12873 MGIID:88479 Length:417 Species:Mus musculus
Sequence 2:NP_648118.1 Gene:CG8562 / 38828 FlyBaseID:FBgn0035779 Length:424 Species:Drosophila melanogaster


Alignment Length:438 Identity:130/438 - (29%)
Similarity:209/438 - (47%) Gaps:40/438 - (9%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MRFFLLMAVIY--TTLAIAPVHFDREKVFRVKLQNEKHASVLKNLTQSIE-LDF-------WYPD 55
            |:|.|.:.|::  .||..|...::..:::.|.......|.:|..|  |:: .||       .:|.
  Fly     1 MKFSLGLLVLFLGATLVAAEQDYEGYRIYEVIPSTADQADLLHQL--SLQGYDFISETRLLGHPS 63

Mouse    56 AIHDIAVNMTVDFRVSEKESQTIQSTLEQHKIHYEILIHDLQEEIEKQF---DVKDEIA-----G 112
            .:           .||..:.:..|..:|..|:...::..:|...|.::|   .::..:|     |
  Fly    64 RV-----------IVSPAQLKHFQQLVEAEKMTLTLVNSNLGASIAEEFAQRQMQRLLAPITGKG 117

Mouse   113 RHSYAKYNDWDKIVSWTEKMLEKHPEMVSRIKIGSTVEDNPLYVLKIGKKDGE--RKAIFMDCGI 175
            |.|..:|...::|:::.:.:.::.|..|....:|.:.|...|..:.|...||:  :|.||||.|.
  Fly   118 RLSTERYYTHEEIINYIDDLAQRFPSRVFVKTVGWSYEQRVLKTITITNGDGKANKKVIFMDGGF 182

Mouse   176 HAREWISPAFCQWFVYQATKSYGKNKIMTKLLDRMNFYVLPVFNVDGY--IWSWTQDRMWRKNRS 238
            |||||||||...:.:.|..:.:.:|   ..||...::.:||:.|.|||  ..:.|..|||||.|.
  Fly   183 HAREWISPAAVLYVIDQLVEQFEEN---AHLLKDYDWVILPLVNADGYEHTQTGTLARMWRKTRQ 244

Mouse   239 --RNQNSTCIGTDLNRNFDVSWDSSPNTNKPCLNVYRGPAPESEKETKAVTNFIRSHLNSIKAYI 301
              .....||.|.|.|||||..|:....::.||.:.|.||...||.||..|.:.:.|..:....|:
  Fly   245 PYTYAGQTCYGADPNRNFDFHWNEEGASSNPCADTYAGPTAFSEPETITVRDLMHSLADRGIMYL 309

Mouse   302 TFHSYSQMLLIPYGYTFKLPPNHQDLLKVARIATDALSTRYETRYIYGPIASTIYKTSGSSLDWV 366
            |.|||...||.|:|:|..||.|.:||..|||...:|:.....|.|.||...:.:|..:|:|.|:.
  Fly   310 TLHSYGNYLLYPWGWTSDLPENWEDLDAVARTGAEAIENATGTVYTYGSSTNVLYIAAGASDDYG 374

Mouse   367 YDLGIKHTFAFELRDKGKSGFLLPESRIKPTCKETMLSVKFIAKYILK 414
            |..|...:...||...|..||..|.:||.....||.:.::.:|:.:::
  Fly   375 YYAGFNVSITMELPGAGSIGFNPPVTRIDEFVTETWIGIRAMAEKVIE 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpa3NP_031779.1 Propep_M14 28..102 CDD:280416 15/81 (19%)
Peptidase_M14_like 114..413 CDD:299699 104/304 (34%)
CG8562NP_648118.1 Propep_M14 30..99 CDD:280416 15/81 (19%)
M14_CP_A-B_like 124..420 CDD:199844 103/298 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848042
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.