DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpa3 and CG8563

DIOPT Version :9

Sequence 1:NP_031779.1 Gene:Cpa3 / 12873 MGIID:88479 Length:417 Species:Mus musculus
Sequence 2:NP_001261515.1 Gene:CG8563 / 38826 FlyBaseID:FBgn0035777 Length:440 Species:Drosophila melanogaster


Alignment Length:431 Identity:122/431 - (28%)
Similarity:190/431 - (44%) Gaps:60/431 - (13%)


- Green bases have known domain annotations that are detailed below.


Mouse    11 YTTLAIAPVHFDREKVFR--VKLQNEKHASVLKNLTQSIELDFWYPDAIHDIAVNMTVDFRVSEK 73
            ||...:.  |.| |..|:  |.||           |...|||||.      :..|.:| ..||.:
  Fly    31 YTKYTVQ--HGD-ENAFKYMVDLQ-----------TNDAELDFWL------LTRNSSV-LTVSPR 74

Mouse    74 ESQTIQSTLEQHKIHYEI-----LIHDLQ------------EEIEKQFDVKDEI---------AG 112
            .....:::|....:.||:     |:..||            |..|.|.|..::.         ..
  Fly    75 RKTQFEASLSSLGVSYEMQPLMELMAALQANSSFADDNYDGEYEECQQDECEQAERPRRRTRRQA 139

Mouse   113 RHSYAKYNDWDKIVSWTEKMLEKHPEMVSRIKIGSTVEDNPLYVLKI--GKKDGERKAIFMDCGI 175
            |..::.|..:.:::|:...:..::|:......:|.:.|...:..|.|  ..:...|:..::....
  Fly   140 RGFFSHYPRYHEVLSFMSGLAARYPQFCRYESLGRSNEGRHIAALSISLNSRVRPRRVAYIQAAT 204

Mouse   176 HAREWISPAFCQWFVYQATKSYGKNKIMTKLLDRMNFYVLPVFNVDGYIWSWTQDRMWRKNRSRN 240
            |.||||:   .|..:|.|.:.....:..|::|..:..:::|:.|.|||.::.|.||.|||||.|.
  Fly   205 HGREWIT---TQTVLYLAYELLSNLRAFTRVLQDVEIFLVPLVNPDGYEYTHTTDRFWRKNRHRY 266

Mouse   241 QNSTCIGTDLNRNFDVSWDSSPNTNKPCLNVYRGPAPESEKETKAVTNFIRSHLNSIKAYITFHS 305
            ...:|.|.|:||||...|:....:...|..||.|.||.||.||.||..::..:.|.:|..:..||
  Fly   267 AGHSCSGVDINRNFGNHWNYQGASQNLCSEVYSGTAPNSEPETSAVVRYLEFNRNRVKLSLDVHS 331

Mouse   306 YSQMLLIPYGYTFK-LPPNHQDLLKVARIATDALSTRYETRYIYGPIASTIYKTSGSSLDWVY-D 368
            :.:.:..||||... :||....|..||..|.:.:.....|||..|..||.:|:.|||..|:.| :
  Fly   332 FGKFIFYPYGYAKNTVPPTVGTLRSVALRAANQIGRYRGTRYTTGTSASILYEASGSLDDFAYGN 396

Mouse   369 LGIKHTFAFELRDKGKSGFLLPESRIKPTCKETMLS-VKFI 408
            |||..::..||..   ..|.:|...|...||||... ::||
  Fly   397 LGIPLSYTLELPG---DEFHVPAHDIIHVCKETFAGFIEFI 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpa3NP_031779.1 Propep_M14 28..102 CDD:280416 20/92 (22%)
Peptidase_M14_like 114..413 CDD:299699 92/300 (31%)
CG8563NP_001261515.1 M14_CP_A-B_like 146..437 CDD:199844 92/295 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848015
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.